BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_F04_e414_12.seq (1648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g57720.1 68414.m06549 elongation factor 1B-gamma, putative / ... 108 1e-23 At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / ... 108 1e-23 At2g27090.1 68415.m03255 expressed protein contains Pfam domains... 31 2.2 At2g17200.1 68415.m01986 ubiquitin family protein weak similarit... 30 5.0 At2g17190.1 68415.m01985 ubiquitin family protein contains INTER... 30 5.0 At3g18830.1 68416.m02391 mannitol transporter, putative similar ... 29 6.7 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 29 8.8 >At1g57720.1 68414.m06549 elongation factor 1B-gamma, putative / eEF-1B gamma, putative similar to elongation factor 1B gamma GI:3868758 from [Oryza sativa] Length = 413 Score = 108 bits (259), Expect = 1e-23 Identities = 49/130 (37%), Positives = 75/130 (57%), Gaps = 3/130 (2%) Frame = +3 Query: 177 SKDPFDSMPKGSFNMDDFKRFYSNEEE---AKSIPYFWEKFDPEHYSIWYCQYKYPEELA 347 +K+P D +P +DD+KR YSN + +I FW+ +DPE YS+W+C YKY +E Sbjct: 253 AKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENM 312 Query: 348 KVFMSCNLITGMFQRLDKMRKQAFASVCLFGGDNDSTISGVWVWRGHELAFPLSPDWQID 527 F++ N + G QR+D RK +F + + G + + G+W++RG E+ D D Sbjct: 313 VSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIP-KFIMDEVYD 371 Query: 528 YESYEWTKLD 557 E YEWTK+D Sbjct: 372 MELYEWTKVD 381 >At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / eEF-1B gamma, putative Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 come from this gene Length = 414 Score = 108 bits (259), Expect = 1e-23 Identities = 49/130 (37%), Positives = 75/130 (57%), Gaps = 3/130 (2%) Frame = +3 Query: 177 SKDPFDSMPKGSFNMDDFKRFYSNEEE---AKSIPYFWEKFDPEHYSIWYCQYKYPEELA 347 +K+P D +P +DD+KR YSN + +I FW+ +DPE YS+W+C YKY +E Sbjct: 254 AKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENM 313 Query: 348 KVFMSCNLITGMFQRLDKMRKQAFASVCLFGGDNDSTISGVWVWRGHELAFPLSPDWQID 527 F++ N + G QR+D RK +F + + G + + G+W++RG E+ D D Sbjct: 314 VSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIP-KFIMDEVYD 372 Query: 528 YESYEWTKLD 557 E YEWTK+D Sbjct: 373 MELYEWTKVD 382 >At2g27090.1 68415.m03255 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 743 Score = 31.1 bits (67), Expect = 2.2 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = +3 Query: 195 SMPKGSFNMDDFKRFYSNEEEAKSIPYFWEKFDPEHYSIWYCQYKYPEELAKVFMSCNLI 374 S GS FK S E+ K +P +P S+ Y + + E ++ S N + Sbjct: 347 SKESGSGASSLFKTCLSCGEDPKDVPE-----EPAQNSVKYLTW-HRTESSRSSSSRNPL 400 Query: 375 TGM-FQRLDKMRKQAFASVCLFGGDNDSTISGVWVW 479 GM ++++ F ++C+ G + ST+ ++ W Sbjct: 401 GGMNSDDVEELNSNLFENICMIAGSHASTLDRLYAW 436 >At2g17200.1 68415.m01986 ubiquitin family protein weak similarity to PLIC-2 (ubiquitin-like type II) [Homo sapiens] GI:9937505; contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain Length = 551 Score = 29.9 bits (64), Expect = 5.0 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 123 KSLQNPL*RKSLMRNPRXSKDPFDSMPKGSFNMDDFKRFYSNEEE 257 ++ +NP + +MRN + +SMP+G FNM +R Y N +E Sbjct: 225 EAARNPELMREMMRNTDRAMSNIESMPEG-FNM--LRRMYENVQE 266 >At2g17190.1 68415.m01985 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 538 Score = 29.9 bits (64), Expect = 5.0 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 123 KSLQNPL*RKSLMRNPRXSKDPFDSMPKGSFNMDDFKRFYSNEEE 257 ++ +NP + +MRN + +SMP+G FNM +R Y N +E Sbjct: 220 EAARNPELMREMMRNTDRAMSNIESMPEG-FNM--LRRMYENVQE 261 >At3g18830.1 68416.m02391 mannitol transporter, putative similar to mannitol transporter [Apium graveolens var. dulce] GI:12004316; contains Pfam profile PF00083: major facilitator superfamily protein Length = 539 Score = 29.5 bits (63), Expect = 6.7 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -1 Query: 508 ESGKASSWPRQTHTPEMVESLSPPKRQTEAKACLRILS 395 E+ A S P H PE V PPKR A AC + S Sbjct: 7 ENRTAPSPPPVKHVPESVLPAKPPKRNNYAFACAILAS 44 >At3g56990.1 68416.m06344 glycine-rich protein conserved hypothetical protein SPCC330.09 - Schizosaccharomyces pombe, PIR:T41319 Length = 711 Score = 29.1 bits (62), Expect = 8.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 507 SPDWQIDYESYEWTKLDPHSPDTK--ALLRDYFSWTGTDKD 623 +PD+QID +SYE+ L P + K +LL ++F D + Sbjct: 510 NPDFQIDKDSYEYGVLHPVASSKKQPSLLDEHFEAVSDDDE 550 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,933,324 Number of Sequences: 28952 Number of extensions: 392368 Number of successful extensions: 932 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 12,070,560 effective HSP length: 85 effective length of database: 9,609,640 effective search space used: 4449263320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -