BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E12_e477_10.seq (1454 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 26 0.61 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 26 0.61 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 26 0.61 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 26 0.61 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 26 0.61 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 26 0.61 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 26 0.61 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 26 0.61 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 1.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 4.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 9.9 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 75 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 26.2 bits (55), Expect = 0.61 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A+ P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 1.1 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +2 Query: 440 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPDPLIKVNDSVQLDISTN 607 H + P Y + +R+A P TH + +Y D + D+STN Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTN 119 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 4.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 41 VXSPGLQXIRTRVSFLFKVLFNMARGPKKHLKRLNAPKAWMLDKLG 178 V SP L + F V+ + R P +++K++N A LD+ G Sbjct: 588 VQSPNLSHPFHLHGYAFNVV-GIGRSPDQNVKKINLKHALDLDRRG 632 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 83 FLFKVLFNMARGPKKHLKRLNAPKAWMLDKLG 178 + F V+ + R P +++K++N A LD+ G Sbjct: 602 YAFNVI-GIGRSPDQNVKKINLKHALDLDRQG 632 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,965 Number of Sequences: 336 Number of extensions: 3446 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 43428200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -