BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E11_e469_09.seq (1425 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 27 0.34 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 26 0.59 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 3.2 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 24 3.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 4.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 4.2 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 4.2 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 27.1 bits (57), Expect = 0.34 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -1 Query: 603 EIXXXXHVC*XIHXPDSNNSVWFINHNVSIRQYQPILFHYKPRTIGKRYRLSRK 442 +I V I+ P+S VWF N RQ Q H + +++ K +L K Sbjct: 95 DIFMREEVALKINLPESRVQVWFKNRRAKCRQQQK--QHNQQQSVEKSSKLKNK 146 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 26.2 bits (55), Expect = 0.59 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -1 Query: 531 NHNVSIRQYQPILFHYKPRTIGKRYRLSRKQIHPSAIFYLY 409 N N + +Y+P L P K YR RK+I A Y Y Sbjct: 205 NCNHLMTKYEPDLDMNHPGFADKEYRARRKEIAEIAFAYKY 245 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 3.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 791 PPPPPPP 811 PPPPPPP Sbjct: 731 PPPPPPP 737 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.8 bits (49), Expect = 3.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 727 GGXRXGGXGXXXGGGGGXE 671 GG R GG G GGG E Sbjct: 92 GGGRGGGRDGDRGDGGGEE 110 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +3 Query: 681 PPPPXXXPXPPXRXPPPPXXXPXP 752 PP P P PP P P P Sbjct: 231 PPHPGLSPHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +3 Query: 681 PPPPXXXPXPPXRXPPPPXXXPXP 752 PP P P PP P P P Sbjct: 123 PPHPGLSPHPPHLSSHPAIVTPGP 146 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 4.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -1 Query: 603 EIXXXXHVC*XIHXPDSNNSVWFINHNVSIRQ 508 +I V I+ P+S VWF N RQ Sbjct: 153 DIFMREEVAVKINLPESRVQVWFKNRRAKCRQ 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,558 Number of Sequences: 336 Number of extensions: 5671 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 42403950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -