BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E10_e461_10.seq (1519 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 4.5 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.4 bits (48), Expect = 4.5 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 490 FLCCTSLG-NSQRNS*DGICSKLRFVFSPIQFEHKLINLSLFSHFNILRKQFRCNDVINV 314 F+C + N ++N + +K + + + ++ L FNIL K NDV+ + Sbjct: 32 FICLFPITINIRKNGLNYNFTKKCYFLRMVLIDLLIVGCILKHIFNILMKNVTLNDVVFI 91 Query: 313 FDS 305 F S Sbjct: 92 FCS 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 265,433 Number of Sequences: 336 Number of extensions: 5408 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45579125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -