BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030905E5_E10_e461_10.seq
(1519 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 4.5
>AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor
candidate 48 protein.
Length = 408
Score = 23.4 bits (48), Expect = 4.5
Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
Frame = -1
Query: 490 FLCCTSLG-NSQRNS*DGICSKLRFVFSPIQFEHKLINLSLFSHFNILRKQFRCNDVINV 314
F+C + N ++N + +K + + + ++ L FNIL K NDV+ +
Sbjct: 32 FICLFPITINIRKNGLNYNFTKKCYFLRMVLIDLLIVGCILKHIFNILMKNVTLNDVVFI 91
Query: 313 FDS 305
F S
Sbjct: 92 FCS 94
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 265,433
Number of Sequences: 336
Number of extensions: 5408
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 45579125
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -