BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E09_e453_09.seq (1540 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0178 + 1386981-1387505 33 0.46 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 32 1.1 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 31 1.8 04_04_0679 + 27214577-27215023 31 1.8 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 31 2.4 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 31 2.4 03_01_0515 - 3864796-3865425 31 3.2 11_06_0610 - 25449085-25453284 30 4.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 4.2 08_01_0059 - 394001-394708 30 4.2 06_03_0790 - 24636805-24637770 30 4.2 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 30 4.2 09_04_0181 + 15371687-15372011,15372105-15372214 30 5.6 08_02_1035 - 23840606-23841109,23841194-23841199 30 5.6 03_01_0023 + 198414-198968 30 5.6 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 7.4 09_04_0182 + 15376025-15376498 29 7.4 09_06_0083 + 20753191-20754480 29 9.8 09_01_0037 - 604001-604957 29 9.8 07_03_1751 - 29215074-29216270 29 9.8 07_03_0558 + 19461369-19462448 29 9.8 04_04_1125 + 31085106-31085714 29 9.8 02_04_0400 - 22608519-22608844,22609044-22609122 29 9.8 02_01_0302 - 2021221-2023305 29 9.8 >06_01_0178 + 1386981-1387505 Length = 174 Score = 33.5 bits (73), Expect = 0.46 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = -3 Query: 878 GXXRGXRGGXXXXGEXXWXXGXXXGGXGXGXXPPXGGXXETXGXXXFGXXEXXSGGXXXA 699 G RG RGG G G GG G G GG G G GG Sbjct: 20 GRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGK 79 Query: 698 XQKXXFFSWGXPXTSGG 648 +K G GG Sbjct: 80 GRKGGAGGHGGAGGGGG 96 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 887 GGXGXXRGXRGGXXXXGEXXWXXGXXXGGXGXGXXPPXGGXXETXGXXXFGXXEXXSGG 711 GG G G +GG G G GG G G GG G G + GG Sbjct: 48 GGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGG 106 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 773 PXGEXXLXPPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 P + PPP P P P S PA P P P P P Sbjct: 82 PRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAP 122 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 31.5 bits (68), Expect = 1.8 Identities = 20/71 (28%), Positives = 22/71 (30%) Frame = -3 Query: 887 GGXGXXRGXRGGXXXXGEXXWXXGXXXGGXGXGXXPPXGGXXETXGXXXFGXXEXXSGGX 708 GG G G GG G + G GG G G GG +G GG Sbjct: 124 GGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRGGGGGGY 183 Query: 707 XXAXQKXXFFS 675 A FS Sbjct: 184 GVAEGSADAFS 194 >04_04_0679 + 27214577-27215023 Length = 148 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/66 (27%), Positives = 20/66 (30%) Frame = -3 Query: 887 GGXGXXRGXRGGXXXXGEXXWXXGXXXGGXGXGXXPPXGGXXETXGXXXFGXXEXXSGGX 708 GG G G G G W G GG G G GG G + GG Sbjct: 79 GGVGGRGGSSGRGGHGGGFGWAGGQGHGGWGAGAGAFGGGSGSGGGGGGWSARGGFHGGD 138 Query: 707 XXAXQK 690 Q+ Sbjct: 139 SHRPQR 144 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 PPP P P P L P+ P PPP P Sbjct: 54 PPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLP 86 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 31.1 bits (67), Expect = 2.4 Identities = 24/89 (26%), Positives = 32/89 (35%), Gaps = 8/89 (8%) Frame = +1 Query: 646 NPPEVXGXPXEKKXXFXXAXXIPPEXXSWXPXQXXPXVSXXPPXGGXXPXPXPP*XXPX- 822 +PPE+ P E + + P P P V+ PP P P PP P Sbjct: 591 SPPEITPSPPEI-TPYPSPPEVVPSPPKITPYPSPPEVTPSPPE--ITPYPSPPDIVPSP 647 Query: 823 -XHXXSPXXFXP------PRXPLXXPXPP 888 + SP + P P P+ P PP Sbjct: 648 PSYEPSPPSYEPSPPEYAPEPPVYAPYPP 676 >03_01_0515 - 3864796-3865425 Length = 209 Score = 30.7 bits (66), Expect = 3.2 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 712 PPEXXSWXPXQXXPXVSXXPPXGGXXPXPXPP*XXPXXHXXSPXXFXPPRXPLXXPXPP 888 PP S P P V+ PP P PP P P PP P PP Sbjct: 42 PPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPP 100 Score = 29.9 bits (64), Expect = 5.6 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +2 Query: 761 PXXHPXGEXXLXPPPXNXXPXPTXPXLXXSXXP----AXPSXPXPPPXP 895 P P E PP P P P + P A P P PPP P Sbjct: 29 PAPSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPP 77 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 PPP + P P L P S P PPP P Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +1 Query: 712 PPEXXSWXPXQXXPXVSXXPPXGGXXPXPXPP*XXPXXHXXSPXXFXPPRXPLXXPXPPX 891 PP S P P P P PP P P PP P+ P PP Sbjct: 1122 PPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPV 1181 Query: 892 SS 897 S Sbjct: 1182 KS 1183 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 PPP + P T S A P P PPP P Sbjct: 93 PPPLSPTPTTTSWTTNSSSISASPILPPPPPPP 125 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXPXT 901 PPP P P P P PS P PP P T Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPT 39 >06_03_0790 - 24636805-24637770 Length = 321 Score = 30.3 bits (65), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 894 GXGGGXGXEGXAGXXEXXRXGXVGXGXXLXGGGXRXXSPXGWXSGN 757 G GGG G G G R G G G GGG G GN Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGN 148 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 PPP + P P + P+ P+ P PPP P Sbjct: 46 PPPPSPPPPPPLDEETLAQFPSPPTNPSPPPPP 78 >09_04_0181 + 15371687-15372011,15372105-15372214 Length = 144 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 894 GXGGGXGXEGXAGXXEXXRXGXVGXGXXLXGGGXRXXSPXGWXSG 760 G G G G AG R G V G G S G SG Sbjct: 67 GSGSGSGSVAGAGSTSGSRSGSVSIGGASSSAGSSAGSYAGSGSG 111 >08_02_1035 - 23840606-23841109,23841194-23841199 Length = 169 Score = 29.9 bits (64), Expect = 5.6 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -3 Query: 896 EXXGGXGXXRGXRGGXXXXGEXXWXXGXXXG-GXGXGXXPPXGGXXETXGXXXFGXXEXX 720 E G G G R G G W G G G G GG T G G Sbjct: 32 EIDPGAGAG-GERTGGSAVGAEAWGDGVAAALGAGTGAGAETGGGVVTGGWAAGGDTGAT 90 Query: 719 SGG 711 +GG Sbjct: 91 AGG 93 >03_01_0023 + 198414-198968 Length = 184 Score = 29.9 bits (64), Expect = 5.6 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 887 GGXGXXRGXRGGXXXXGEXXWXXGXXXGGXGXGXXPPXGGXXETXGXXXFGXXEXXSGG 711 GG G G GG G G GG G G GG G G GG Sbjct: 37 GGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGG 95 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPPXP 895 PPP P P P + P PS P PPP P Sbjct: 690 PPP----PPPPLPPANRTNGPGVPSAPPPPPPP 718 >09_04_0182 + 15376025-15376498 Length = 157 Score = 29.5 bits (63), Expect = 7.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 900 VXGXGGGXGXEGXAGXXEXXRXGXVGXGXXLXGGGXRXXSPXGWXSGNXR 751 V G G G G G R G V G G S G SG R Sbjct: 75 VSGSGSGSGSAAGVGSTSGSRSGSVSVGGASSSAGSSAGSSAG--SGGSR 122 >09_06_0083 + 20753191-20754480 Length = 429 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 800 PPXNXXPX-PTXPXLXXSXXPAXPSXPXPPPXP 895 PP + P P P PA P P PPP P Sbjct: 234 PPVDTMPDQPLLPPPPADATPATPDLPLPPPPP 266 >09_01_0037 - 604001-604957 Length = 318 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 791 LXPPPXNXXPXPTXPXLXXSXXPAXPSX--PXPPPXPXTXXXAXF 919 L PPP + P PT P P P P PPP P A F Sbjct: 230 LQPPPPSQMPPPT-PSCVRQEPPQMPFQLQPPPPPRPSAPFSAEF 273 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.1 bits (62), Expect = 9.8 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 2/83 (2%) Frame = -3 Query: 887 GGXGXXRGXRGGXXXXGEXXWXXGXXXG--GXGXGXXPPXGGXXETXGXXXFGXXEXXSG 714 GG G G GG G G G G G G GG G G G Sbjct: 275 GGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKG 334 Query: 713 GXXXAXQKXXFFSWGXPXTSGGF 645 G F G GGF Sbjct: 335 GGVGGGAGGGFGGGGGAGAGGGF 357 >07_03_0558 + 19461369-19462448 Length = 359 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -2 Query: 894 GXGGGXGXEGXAGXXEXXRXGXVGXGXXLXGGGXRXXSPXGWXSGNXRXPLXWGPXXXF 718 G GGG G G G G G G L GG G G L G F Sbjct: 59 GGGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGF 117 >04_04_1125 + 31085106-31085714 Length = 202 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 797 PPPXNXXPXPTXPXLXXSXXPAXPSXPXPPP 889 PPP PT P + PA P+ P P P Sbjct: 47 PPPTPTPATPTTPPTPWTPPPATPTPPTPTP 77 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 894 GXGGGXGXEGXAGXXEXXRXGXVGXGXXLXGGGXRXXSPXGWXSGNXRXP 745 G GGG G G G R G G G GGG G G P Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYP 95 >02_01_0302 - 2021221-2023305 Length = 694 Score = 29.1 bits (62), Expect = 9.8 Identities = 24/95 (25%), Positives = 28/95 (29%), Gaps = 1/95 (1%) Frame = +3 Query: 606 YSNFPXAEPXXSFEPPXSAW-XPPXKKXXLLXXPXXPXGXXLXXPKXXVPGGFXXXTRWG 782 Y P + P S+ P S++ PP P P P P G T Sbjct: 414 YPQPPSSSPTPSYPSPSSSYPAPPGSNTP--SYPSPPSSAT--TPSSHSPPGGSSST--- 466 Query: 783 XXXXPXPPXXXPXXPXXLXSXXPPXPXXPXXPXPP 887 P P P P PP P P PP Sbjct: 467 TPSYPSPNGGKPSTPSH---PSPPGSTTPSYPSPP 498 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,259,582 Number of Sequences: 37544 Number of extensions: 523004 Number of successful extensions: 3320 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2924 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4954100116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -