BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E09_e453_09.seq (1540 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 2.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 9.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.6 bits (51), Expect = 2.3 Identities = 15/56 (26%), Positives = 21/56 (37%) Frame = -1 Query: 577 FGKPATKNEWVKARIIQDKVKYIWTSGRLCDFKGCNRPDLLPNEVNGWFWTAELQK 410 FG A WV+ W S +CD + N VN W WT +++ Sbjct: 33 FGAEANTPGWVEESFTNFDKGINWRSYVVCD--------VAYNNVNNWLWTPFIER 80 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 9.3 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -1 Query: 451 NEVNGWFWTAELQKLA 404 NE+N W+W ++ L+ Sbjct: 361 NEMNKWWWNMKISNLS 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,411 Number of Sequences: 438 Number of extensions: 4718 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53950875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -