BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E08_e445_10.seq (1552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 25 2.0 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 8.0 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 301 QRIFPESASRRFNQFIWKPLRMVSTRSC 218 +RI ++ + N+ IWK LR TR C Sbjct: 248 RRIAAVASEKIKNEIIWKKLREDYTRQC 275 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = -2 Query: 165 ILCNQVVTTILSLYPLFVIYLYKHKMYKWP 76 IL NQ++T + + L+ +WP Sbjct: 88 ILLNQLITPLFFFHSFMTSVLFSQVASRWP 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 265,914 Number of Sequences: 336 Number of extensions: 5073 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46705800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -