BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E08_e445_10.seq (1552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8334| Best HMM Match : MIB_HERC2 (HMM E-Value=0) 56 1e-07 SB_11438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 >SB_8334| Best HMM Match : MIB_HERC2 (HMM E-Value=0) Length = 636 Score = 55.6 bits (128), Expect = 1e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 258 NWLNLRDADSGKILWQYNEDMSNPEVEHEA 347 NW+NLRDAD+GK+LWQ +ED+S P VEHEA Sbjct: 570 NWMNLRDADTGKVLWQGSEDLSLPGVEHEA 599 >SB_11438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 37.5 bits (83), Expect = 0.029 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 366 LKCRVVSRELNFS-SIESMDRFRLEQKVLFKGRCLEEWFFEFGYVIPNSTNTWQSVIE 536 LK + V + F+ + + FR+ ++ + + L+ + FEFG+ IPNS NT + + E Sbjct: 121 LKLKTVGATVEFTVGDKPVTNFRMVERHYYHEKLLKSFDFEFGFCIPNSKNTCEHIYE 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,139,553 Number of Sequences: 59808 Number of extensions: 614353 Number of successful extensions: 1141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5058981887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -