BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E06_e429_10.seq (1516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 1.1 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 25 4.3 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 25 4.3 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 1.1 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 317 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 445 + G Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 25.4 bits (53), Expect = 4.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 349 PRLGAGLMTGLLADAVGLARVLRH 278 PR+ GL G++ +GLA +L+H Sbjct: 452 PRICIGLRFGMMQARIGLALLLKH 475 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 25.4 bits (53), Expect = 4.3 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 349 PRLGAGLMTGLLADAVGLARVLR--H*YVDIIDEVR 248 PR+ G+ GLL +GLA +LR H +D D R Sbjct: 439 PRICIGMRFGLLQTRLGLAMLLRNYHFTIDPSDAAR 474 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 945,081 Number of Sequences: 2352 Number of extensions: 18183 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177594615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -