BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E05_e421_09.seq (1550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 65 2e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 58 1e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 58 1e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 58 1e-08 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 58 2e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 57 3e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_44609| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-24) 56 8e-08 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 8e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 56 1e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 5e-07 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 50 5e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 49 1e-05 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 49 1e-05 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 49 1e-05 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 49 1e-05 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 49 1e-05 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 49 1e-05 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 49 1e-05 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 48 2e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30) 48 3e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 48 3e-05 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 48 3e-05 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 48 3e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 48 3e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 48 3e-05 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 48 3e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 48 3e-05 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 45 1e-04 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 45 1e-04 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 45 1e-04 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 45 1e-04 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 45 1e-04 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 45 1e-04 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 45 1e-04 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 45 1e-04 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 45 1e-04 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 45 1e-04 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 45 1e-04 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 45 1e-04 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 45 1e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 45 1e-04 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 45 1e-04 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 45 1e-04 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 45 1e-04 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 45 1e-04 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 45 1e-04 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 45 1e-04 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 45 1e-04 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 45 1e-04 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 45 1e-04 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 45 1e-04 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 45 1e-04 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 45 1e-04 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 45 1e-04 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 45 1e-04 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 45 1e-04 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 45 1e-04 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 45 1e-04 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 45 1e-04 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 45 1e-04 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 45 1e-04 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 45 1e-04 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 45 1e-04 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 45 1e-04 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 45 1e-04 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 45 1e-04 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 45 1e-04 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 45 1e-04 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_21600| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 45 2e-04 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 45 2e-04 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 45 2e-04 SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 45 2e-04 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 45 2e-04 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 44 3e-04 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) 44 3e-04 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) 44 3e-04 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) 44 3e-04 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 44 3e-04 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 44 3e-04 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 44 3e-04 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 44 3e-04 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 44 3e-04 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 44 3e-04 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 44 3e-04 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 44 3e-04 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 44 3e-04 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 44 3e-04 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 44 3e-04 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 44 3e-04 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 44 3e-04 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 44 3e-04 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 44 3e-04 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 44 3e-04 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 44 3e-04 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 44 3e-04 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 44 3e-04 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 44 3e-04 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 44 3e-04 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 44 3e-04 SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 44 3e-04 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 44 3e-04 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 44 3e-04 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 44 3e-04 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_21743| Best HMM Match : rve (HMM E-Value=4e-17) 44 3e-04 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 44 3e-04 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 44 3e-04 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 44 3e-04 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 44 3e-04 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 44 4e-04 SB_32381| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 44 4e-04 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 43 6e-04 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 43 6e-04 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 43 6e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 43 6e-04 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 43 6e-04 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 43 8e-04 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 43 8e-04 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 8e-04 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 8e-04 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 42 0.001 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_6211| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 42 0.001 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 42 0.001 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 42 0.001 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 42 0.001 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 42 0.001 SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) 42 0.001 SB_12920| Best HMM Match : zf-CCHC (HMM E-Value=6.2e-05) 42 0.001 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 42 0.001 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 42 0.002 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 42 0.002 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 41 0.002 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 41 0.002 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 41 0.003 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 41 0.003 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 41 0.003 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 41 0.003 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 41 0.003 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 41 0.003 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 41 0.003 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 >SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 85.4 bits (202), Expect = 1e-16 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 3/76 (3%) Frame = +2 Query: 62 GNSARG-PDEPS--CYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCPDGTKTC 232 G+ AR P+E CY C HIAR+CPE +++ ++CY C KSGH +R+C D TK C Sbjct: 85 GHFARDCPNEKKEGCYTCGDESHIARDCPEK-KESPGESCYRCGKSGHFARDCTDDTK-C 142 Query: 233 YVCGKPGHISRDCDEE 280 Y CG GHI RDC EE Sbjct: 143 YKCGNTGHIRRDCPEE 158 Score = 80.2 bits (189), Expect = 4e-15 Identities = 34/76 (44%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Frame = +2 Query: 71 ARGPDEPSCYNCNKTGHIARNC---PEGGRDNSNQTCYNCNKSGHISRNC--PDGTKTCY 235 A G D+P CY+C K GHI+R+C GG N + CY CN SGH +R+C CY Sbjct: 20 ADGDDKPVCYSCGKKGHISRDCKNPSSGGSRNRDVVCYRCNMSGHFARDCDAESSRDVCY 79 Query: 236 VCGKPGHISRDCDEER 283 C + GH +RDC E+ Sbjct: 80 RCQETGHFARDCPNEK 95 Score = 76.6 bits (180), Expect = 5e-14 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = +2 Query: 95 CYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCPDGTKT-CYVCGKPGHISRDC 271 CY CN +GH AR+C ++S CY C ++GH +R+CP+ K CY CG HI+RDC Sbjct: 56 CYRCNMSGHFARDCDA---ESSRDVCYRCQETGHFARDCPNEKKEGCYTCGDESHIARDC 112 Query: 272 DEERN*HAPNNS*Y 313 E++ +P S Y Sbjct: 113 PEKK--ESPGESCY 124 Score = 73.3 bits (172), Expect = 5e-13 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 8/71 (11%) Frame = +2 Query: 92 SCYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCPD----GTK----TCYVCGK 247 +CY C KT H+A NCP+ D+ CY+C K GHISR+C + G++ CY C Sbjct: 3 ACYQCGKTDHLASNCPDADGDD-KPVCYSCGKKGHISRDCKNPSSGGSRNRDVVCYRCNM 61 Query: 248 PGHISRDCDEE 280 GH +RDCD E Sbjct: 62 SGHFARDCDAE 72 Score = 54.4 bits (125), Expect = 2e-07 Identities = 21/40 (52%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = +2 Query: 164 QTCYNCNKSGHISRNCPDG----TKTCYVCGKPGHISRDC 271 + CY C K+ H++ NCPD CY CGK GHISRDC Sbjct: 2 KACYQCGKTDHLASNCPDADGDDKPVCYSCGKKGHISRDC 41 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 65.7 bits (153), Expect = 9e-11 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 12/77 (15%) Frame = +2 Query: 77 GPDEPSCYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCPD------------G 220 G +C+ CN+ GH AR CP D+ C+ CN+SGH +R CP+ Sbjct: 460 GGGSRTCHKCNEEGHFARECPNA--DSGGNKCFKCNESGHFARECPNSGGGGGGFGGGSS 517 Query: 221 TKTCYVCGKPGHISRDC 271 TCY C + GH +R+C Sbjct: 518 GSTCYKCNETGHFAREC 534 Score = 65.3 bits (152), Expect = 1e-10 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 9/79 (11%) Frame = +2 Query: 62 GNSARGPDEPSCYNCNKTGHIARNCPE---------GGRDNSNQTCYNCNKSGHISRNCP 214 G G +CY CN+TGH AR CP GG +S+ TC+ C ++GH +R CP Sbjct: 510 GGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFARECP 569 Query: 215 DGTKTCYVCGKPGHISRDC 271 + + G+ GH +R+C Sbjct: 570 NES----AAGENGHFAREC 584 Score = 63.3 bits (147), Expect = 5e-10 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 21/83 (25%) Frame = +2 Query: 95 CYNCNKTGHIARNCPEGGRD-------NSNQTCYNCNKSGHISRNCPD------------ 217 C+ CN++GH AR CP G +S TCY CN++GH +R CP+ Sbjct: 489 CFKCNESGHFARECPNSGGGGGGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGG 548 Query: 218 --GTKTCYVCGKPGHISRDCDEE 280 TC+ C + GH +R+C E Sbjct: 549 GSSDSTCFKCQQTGHFARECPNE 571 Score = 58.0 bits (134), Expect = 2e-08 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 9/61 (14%) Frame = +2 Query: 62 GNSARGPDEPSCYNCNKTGHIARNCPE---------GGRDNSNQTCYNCNKSGHISRNCP 214 G G +CY CN+TGH AR CP GG +S+ TC+ C ++GH +R CP Sbjct: 592 GGFGGGSSGSTCYKCNETGHFARECPNAESSGGGFGGGGGSSDSTCFKCQQTGHFARECP 651 Query: 215 D 217 + Sbjct: 652 N 652 Score = 52.0 bits (119), Expect = 1e-06 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 21/78 (26%) Frame = +2 Query: 110 KTGHIARNCPEG-------GRDNSNQTCYNCNKSGHISRNCPD--------------GTK 226 + GH AR CP G +S TCY CN++GH +R CP+ Sbjct: 576 ENGHFARECPNAESNGGGFGGGSSGSTCYKCNETGHFARECPNAESSGGGFGGGGGSSDS 635 Query: 227 TCYVCGKPGHISRDCDEE 280 TC+ C + GH +R+C E Sbjct: 636 TCFKCQQTGHFARECPNE 653 Score = 51.6 bits (118), Expect = 2e-06 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +2 Query: 143 GGRDNSNQTCYNCNKSGHISRNCPD---GTKTCYVCGKPGHISRDC 271 GG ++TC+ CN+ GH +R CP+ G C+ C + GH +R+C Sbjct: 457 GGGGGGSRTCHKCNEEGHFARECPNADSGGNKCFKCNESGHFAREC 502 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 64.9 bits (151), Expect = 2e-10 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = +2 Query: 851 SRITIXWPXFYXVXTWENPGVPNLIXLAXIPXSPAGVXAKRPXPXAFP 994 SRITI WP FY V T + +PNLI L IP SPAGV AKRP P A P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 49 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.9 bits (141), Expect = 3e-09 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = -2 Query: 991 KGXRXGPFRXYXSWRXGDXXKAN*VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 KG R G F + G KA +G A+ FPS D VKRRP NCNTTHYRANW Sbjct: 7 KGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -3 Query: 999 TXGKAIGXGLFAXTPAGEXGXXARXIKLG 913 T GK GLFA TPAGE G + IKLG Sbjct: 4 TVGKGDRCGLFAITPAGERGMCCKAIKLG 32 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/64 (46%), Positives = 34/64 (53%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGDXXKAN*VGYARVFPSXDXVKRRPXNCNTTHY 845 +HSPFR N W+G G A + + FPS D VKRRP NCNTTHY Sbjct: 588 SHSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHY 644 Query: 844 RANW 833 RANW Sbjct: 645 RANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/64 (46%), Positives = 34/64 (53%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGDXXKAN*VGYARVFPSXDXVKRRPXNCNTTHY 845 +HSPFR N W+G G A + + FPS D VKRRP NCNTTHY Sbjct: 31 SHSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHY 87 Query: 844 RANW 833 RANW Sbjct: 88 RANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/64 (46%), Positives = 34/64 (53%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGDXXKAN*VGYARVFPSXDXVKRRPXNCNTTHY 845 +HSPFR N W+G G A + + FPS D VKRRP NCNTTHY Sbjct: 31 SHSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHY 87 Query: 844 RANW 833 RANW Sbjct: 88 RANW 91 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 58.0 bits (134), Expect = 2e-08 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 9/61 (14%) Frame = +2 Query: 62 GNSARGPDEPSCYNCNKTGHIARNCPE---------GGRDNSNQTCYNCNKSGHISRNCP 214 G G +CY CN+TGH AR CP GG +S+ TC+ C ++GH +R CP Sbjct: 15 GGFGGGSSGSTCYKCNETGHFARECPNAESSGGGFGGGGGSSDSTCFKCQQTGHFARECP 74 Query: 215 D 217 + Sbjct: 75 N 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 21/75 (28%) Frame = +2 Query: 119 HIARNCPEG-------GRDNSNQTCYNCNKSGHISRNCPD--------------GTKTCY 235 H AR CP G +S TCY CN++GH +R CP+ TC+ Sbjct: 2 HFARECPNAESNGGGFGGGSSGSTCYKCNETGHFARECPNAESSGGGFGGGGGSSDSTCF 61 Query: 236 VCGKPGHISRDCDEE 280 C + GH +R+C E Sbjct: 62 KCQQTGHFARECPNE 76 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 57.2 bits (132), Expect = 3e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -2 Query: 931 KAN*VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 KA +G A VFPS D VKRRP NCNTTHYRANW Sbjct: 21 KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 37.5 bits (83), Expect = 0.029 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 987 AIGXGLFAXTPAGEXGXXARXIKLG 913 AIG GLFA TPAGE G + IKLG Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLG 26 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 57.2 bits (132), Expect = 3e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -2 Query: 931 KAN*VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 KA +G A VFPS D VKRRP NCNTTHYRANW Sbjct: 35 KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = -3 Query: 1026 LPIPHSGXXTXGKAIGXGLFAXTPAGEXGXXARXIKLG 913 +P G+AIG GLFA TPAGE G + IKLG Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.8 bits (131), Expect = 4e-08 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +2 Query: 836 IRPIVSRITIXWPXFYXVXTWENPGVPNLIXLAXIPXSPAGVXAK 970 +RP+VSRITI W FY V T + +PNLI L IP SPAGV A+ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAE 77 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 56.4 bits (130), Expect = 6e-08 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +2 Query: 869 WPXFYXVXTWENPGVPNLIXLAXIPXSPAGVXAKRPXPXAFP 994 WP FY V T + +PNLI L IP SPAGV AKRP P A P Sbjct: 63 WPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 104 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 56.4 bits (130), Expect = 6e-08 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +2 Query: 869 WPXFYXVXTWENPGVPNLIXLAXIPXSPAGVXAKRPXPXAFP 994 WP FY V T + +PNLI L IP SPAGV AKRP P A P Sbjct: 58 WPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 99 >SB_44609| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-24) Length = 283 Score = 56.0 bits (129), Expect = 8e-08 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 9/71 (12%) Frame = +2 Query: 92 SCYNCNKTGHIARNCPEGGRDNSN-QTCYNCNKSGHISRNCPDGTKT--------CYVCG 244 +C++C + GH A +CP+ + ++ CY C + HI+++C T T C++CG Sbjct: 140 TCFHCRELGHRAADCPQTKKTSAGVGVCYKCRATSHITKHCKVTTTTESPFPFAKCFICG 199 Query: 245 KPGHISRDCDE 277 + GH+S C + Sbjct: 200 ETGHLSSSCPD 210 Score = 54.0 bits (124), Expect = 3e-07 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 11/75 (14%) Frame = +2 Query: 95 CYNCNKTGHIARNCPEGGRDNSN---QTCYNCNKSGHISRNCPDGTK-------TCYVCG 244 CY C T HI ++C S C+ C ++GH+S +CPD K C CG Sbjct: 167 CYKCRATSHITKHCKVTTTTESPFPFAKCFICGETGHLSSSCPDNPKGLYPEGGGCKECG 226 Query: 245 KPGHISRDCDE-ERN 286 H+ RDC E ERN Sbjct: 227 SVEHLRRDCPELERN 241 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 56.0 bits (129), Expect = 8e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = -1 Query: 1022 PFPIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 PF IQ +LLE SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 11 PFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 55.6 bits (128), Expect = 1e-07 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +2 Query: 65 NSARGPDEPSCYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCPDG---TKTCY 235 + + GP S Y + G+ + G D + TC+ C + GH +R CP G + TC+ Sbjct: 348 SQSNGPSTDSPYQKSPFGY-GSSGTTGRSDRGSGTCHKCGEVGHFARECPTGRGQSDTCH 406 Query: 236 VCGKPGHISRDC 271 CG+ GH SR+C Sbjct: 407 KCGETGHYSREC 418 Score = 53.2 bits (122), Expect = 5e-07 Identities = 24/51 (47%), Positives = 31/51 (60%) Frame = +2 Query: 62 GNSARGPDEPSCYNCNKTGHIARNCPEGGRDNSNQTCYNCNKSGHISRNCP 214 G S RG +C+ C + GH AR CP G R S+ TC+ C ++GH SR CP Sbjct: 373 GRSDRGSG--TCHKCGEVGHFARECPTG-RGQSD-TCHKCGETGHYSRECP 419 Score = 30.3 bits (65), Expect = 4.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 218 GTKTCYVCGKPGHISRDCDEER 283 G+ TC+ CG+ GH +R+C R Sbjct: 378 GSGTCHKCGEVGHFARECPTGR 399 Score = 30.3 bits (65), Expect = 4.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 68 SARGPDEPSCYNCNKTGHIARNCPEGG 148 + RG + +C+ C +TGH +R CP G Sbjct: 397 TGRGQSD-TCHKCGETGHYSRECPTLG 422 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 55.6 bits (128), Expect = 1e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 919 VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 + +A VFPS D VKRRP NCNTTHYRANW Sbjct: 33 LAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 38.3 bits (85), Expect = 0.016 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -3 Query: 993 GKAIGXGLFAXTPAGEXGXXARXIKL 916 G+AIG GLFA TPAGE G + IKL Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKL 33 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 55.2 bits (127), Expect = 1e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 931 KAN*VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 ++N +A VFPS D VKRRP NCNTTHYRANW Sbjct: 27 ESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/51 (54%), Positives = 30/51 (58%) Frame = -1 Query: 1022 PFPIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 PF IQ +L E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/51 (54%), Positives = 30/51 (58%) Frame = -1 Query: 1022 PFPIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 PF IQ +L E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 904 VFPSXDXVKRRPXNCNTTHYRANW 833 VFPS D VKRRP NCNTTHYRANW Sbjct: 1876 VFPSHDVVKRRPVNCNTTHYRANW 1899 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = -3 Query: 1026 LPIPHSGXXTXGKAIGXGLFAXTPAGEXGXXARXIKLGTPGF 901 +P G+AIG GLFA TPAGE G + IKL TP F Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 52.4 bits (120), Expect = 9e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 919 VGYARVFPSXDXVKRRPXNCNTTHYRANW 833 +G + FPS D VKRRP NCNTTHYRANW Sbjct: 74 LGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 36.7 bits (81), Expect = 0.050 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 1020 IPHSGXXTXGKAIGXGLFAXTPAGEXGXXAR-XIKLG 913 +P G+AIG GLFA TPAGE G + +KLG Sbjct: 39 LPSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLG 75 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 52.0 bits (119), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 836 IRPIVSRITIXWPXFYXVXTWENPGVPNLIXLAXIP 943 IRPIVSRITI WP FY WENPGV L LA P Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHP 53 Score = 33.5 bits (73), Expect = 0.47 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +1 Query: 886 RXDLGKPWRTQLNXPCXXPXFASWXXXEKARTD 984 R D P QLN P FASW E+ARTD Sbjct: 35 RRDWENPGVNQLNRLAAHPPFASWRSSEEARTD 67 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 51.6 bits (118), Expect = 2e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 901 FPSXDXVKRRPXNCNTTHYRANW 833 FPS D VKRRP NCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 51.6 bits (118), Expect = 2e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 901 FPSXDXVKRRPXNCNTTHYRANW 833 FPS D VKRRP NCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 51.6 bits (118), Expect = 2e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +2 Query: 842 PIVSRITIXWPXFYXVXTWENPGVPNLIXLAXIPXSPAGV 961 P +SRITI WP FY V T + +PNLI L IP SPAG+ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGL 116 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 51.6 bits (118), Expect = 2e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 901 FPSXDXVKRRPXNCNTTHYRANW 833 FPS D VKRRP NCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 Score = 34.3 bits (75), Expect = 0.27 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFP 897 E SVRA S QLAK G LSWV GFP Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFP 59 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.4 bits (115), Expect = 4e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +2 Query: 851 SRITIXWPXFYXVXTWENPGVPNLIXLAXIPXSPAGVXAK 970 SRITI WP FY V T + +PNLI L IP SPAGV ++ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSE 41 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 931 KAN*VGYARVFPSXDXVKRRPXNCNTTHYRAN 836 KA +G AR FPS D KRRP NCNTTHYRAN Sbjct: 66 KAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -3 Query: 993 GKAIGXGLFAXTPAGEXGXXARXIKLG 913 G++IG GLFA TPAGE G + IKLG Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLG 71 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.2 bits (112), Expect = 9e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 931 KAN*VGYARVFPSXDXVKRRPXNCNTTHYRAN 836 KA +G A VF S D VKRRP NCNTTHYRAN Sbjct: 9 KAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 218 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = -1 Query: 1001 KLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 +L E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 3 QLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 373 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 289 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 29 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 263 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 447 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 282 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 132 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 583 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 497 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 48.8 bits (111), Expect = 1e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 181 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 48.0 bits (109), Expect = 2e-05 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 P + E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 47 PFRLRNCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 48.0 bits (109), Expect = 2e-05 Identities = 27/57 (47%), Positives = 29/57 (50%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL*YDSL 846 P + E SVRA S QLAK G LSWV GF +S RCKT A E D L Sbjct: 6 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/39 (53%), Positives = 22/39 (56%) Frame = +1 Query: 868 LAXVLXRXDLGKPWRTQLNXPCXXPXFASWXXXEKARTD 984 LA VL R D P TQLN P FASW E+ARTD Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 123 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 48.0 bits (109), Expect = 2e-05 Identities = 29/58 (50%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = -1 Query: 1022 PFPIQXXKLL----ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 PFP L E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 185 PFPSANSNKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30) Length = 1246 Score = 47.6 bits (108), Expect = 3e-05 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 128 RNCPEGGRDNSNQTCYNCNK-SGHISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 R P G NS+ +C+ C K +GH+ ++CP C CGK GH + C + H N Sbjct: 232 RRPPTPGSHNSSTSCHWCGKKAGHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 290 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 894 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 230 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 363 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 47.6 bits (108), Expect = 3e-05 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +2 Query: 170 CYNCNKSGHISRN--CPDGTKTCYVCGKPGHISRDCDEER 283 C+NCN++GHI+RN CP ++ C CG GH S C R Sbjct: 1227 CFNCNRTGHIARNPVCPAKSQNCNSCGIKGHFSACCKTTR 1266 Score = 46.0 bits (104), Expect = 8e-05 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +2 Query: 65 NSARGPDEPSCYNCNKTGHIARN--CPEGGRDNSNQTCYNCNKSGHISRNC 211 N G ++ C+NCN+TGHIARN CP +Q C +C GH S C Sbjct: 1217 NRKPGLNQGRCFNCNRTGHIARNPVCPA-----KSQNCNSCGIKGHFSACC 1262 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 273 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 257 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.6 bits (108), Expect = 3e-05 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGD 938 +HSPFR N W+G R GP R Y SWR GD Sbjct: 31 SHSPFRLRNCWEGDRCGPLRYYASWRKGD 59 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 246 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 124 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 227 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 88 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 396 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 46.8 bits (106), Expect = 5e-05 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -1 Query: 1022 PFPIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXE 864 P+ + E SVRA S QLAK G LSWV GF +S RCKT A E Sbjct: 526 PYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 46.8 bits (106), Expect = 5e-05 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -1 Query: 983 SVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 3 SVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 46.8 bits (106), Expect = 5e-05 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -1 Query: 983 SVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 SVRA S QLAK G LSWV GF +S RCKT A EL Sbjct: 3 SVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA+S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRAYSLFRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1957 Score = 46.0 bits (104), Expect = 8e-05 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +2 Query: 170 CYNCNKSGHISRN--CPDGTKTCYVCGKPGHISRDCDEER 283 C+NCN++GHI+R+ CP +++C CG GH S C R Sbjct: 932 CFNCNRTGHIARDPVCPAKSQSCNSCGIKGHFSACCKTTR 971 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +2 Query: 65 NSARGPDEPSCYNCNKTGHIARN--CPEGGRDNSNQTCYNCNKSGHISRNC 211 N G ++ C+NCN+TGHIAR+ CP +Q+C +C GH S C Sbjct: 922 NRQSGLNQGRCFNCNRTGHIARDPVCPA-----KSQSCNSCGIKGHFSACC 967 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 45.6 bits (103), Expect = 1e-04 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = -1 Query: 983 SVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 SVR +S QL K G LSWV GF +S RCKT A EL Sbjct: 336 SVRTYSLLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 474 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 522 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P+ E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 365 PVVLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 413 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 67 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 115 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 648 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 696 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -1 Query: 1001 KLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 +L E SVRA S QLAK G LSWV F +S RCKT A EL Sbjct: 3 QLWEGRSVRASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 557 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 605 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 181 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 37.5 bits (83), Expect = 0.029 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +1 Query: 868 LAXVLXRXDLGKPWRTQLNXPCXXPXFASWXXXEKARTD 984 LA VL R D TQLN P FASW E+ARTD Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTD 553 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 67 PFRLRNYWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 115 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 34 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 82 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 45.2 bits (102), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 889 DXVKRRPXNCNTTHYRANW 833 D VKRRP NCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 851 SRITIXWPXFYXVXTWENPGVPNLIXLAXIP 943 SRITI WP FY V WENPGV L LA P Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHP 32 Score = 32.7 bits (71), Expect = 0.81 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 Query: 904 PWRTQLNXPCXXPXFASWXXXEKARTD 984 P TQLN P FASW E+ARTD Sbjct: 20 PGVTQLNRLAAHPPFASWRNSEEARTD 46 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 13 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/62 (41%), Positives = 31/62 (50%) Frame = +1 Query: 799 KKKKNSRGGPVXXXXXXXXXXXXLAXVLXRXDLGKPWRTQLNXPCXXPXFASWXXXEKAR 978 K+K ++RG P+ LA VL R D P TQLN P FASW E+AR Sbjct: 34 KRKLSNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 91 Query: 979 TD 984 TD Sbjct: 92 TD 93 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 190 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 238 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 45.2 bits (102), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 889 DXVKRRPXNCNTTHYRANW 833 D VKRRP NCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 916 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 964 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 264 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 312 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 31.5 bits (68), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 991 KGXRXGPFRXYXSWRXGD 938 KG R GP R Y SWR GD Sbjct: 96 KGDRCGPLRYYASWRKGD 113 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 70 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 118 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -1 Query: 1016 PIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 P + E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 21 PFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 >SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +2 Query: 137 PEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 P G NS+ +C+ C K H+ ++CP C CGK GH + C ++ H N Sbjct: 242 PTPGSHNSSTSCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSDKQVHEVN 297 >SB_21600| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 216 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 128 RNCPEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 R P G NS+ +C+ C K H+ ++CP C CGK GH + C + H N Sbjct: 81 RRPPTPGSHNSSTSCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 139 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 44.8 bits (101), Expect = 2e-04 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXAXEL 861 E SVRA S QLAK G LSWV GF +S RCKT A L Sbjct: 1859 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAKAL 1902 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/62 (41%), Positives = 29/62 (46%) Frame = +1 Query: 799 KKKKNSRGGPVXXXXXXXXXXXXLAXVLXRXDLGKPWRTQLNXPCXXPXFASWXXXEKAR 978 K+ N RG P+ LA VL R D P TQLN P FASW E+AR Sbjct: 508 KESANQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 565 Query: 979 TD 984 TD Sbjct: 566 TD 567 >SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) Length = 469 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 128 RNCPEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 R P G NS+ +C+ C K H+ ++CP C CGK GH + C + H N Sbjct: 225 RRPPTPGSHNSSTSCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 283 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 44.8 bits (101), Expect = 2e-04 Identities = 24/50 (48%), Positives = 27/50 (54%) Frame = -1 Query: 1019 FPIQXXKLLERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 + I+ E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 460 YSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 10/72 (13%) Frame = +2 Query: 95 CYNCNKTGHIARNCP----------EGGRDNSNQTCYNCNKSGHISRNCPDGTKTCYVCG 244 C NC K GH+ R C +GG+ + C+ C + H ++C C CG Sbjct: 517 CDNCGKVGHLKRVCQSKECKKXXXXQGGKPKT--ACHRCGSAEHDGKSCKYKKYKCDNCG 574 Query: 245 KPGHISRDCDEE 280 K GH+ R C + Sbjct: 575 KVGHLKRVCQSK 586 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 140 EGGRDNSNQTCYNCNKSGHISRNCPDGTKTCYVCGKPGHISRDCDEE 280 +GG+ + C+ C + H ++C C CGK GH+ R C + Sbjct: 489 KGGKPKT--ACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVCQSK 533 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 152 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 192 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) Length = 517 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 128 RNCPEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 R P G NS+ C+ C K H+ ++CP C CGK GH + C + H N Sbjct: 100 RRPPTPGSHNSSTPCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 158 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) Length = 1052 Score = 44.0 bits (99), Expect = 3e-04 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 137 PEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 P G NS+ +C+ C K H+ ++CP C CGK GH + C + H N Sbjct: 227 PTPGSHNSSTSCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 282 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 229 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 269 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) Length = 991 Score = 44.0 bits (99), Expect = 3e-04 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 137 PEGGRDNSNQTCYNCNKSG-HISRNCPDGTKTCYVCGKPGHISRDCDEERN*HAPN 301 P G NS+ +C+ C K H+ ++CP C CGK GH + C + H N Sbjct: 83 PTPGSHNSSTSCHWCGKKADHVKKDCPAKDAKCRNCGKTGHYAVVCRSNKQVHEVN 138 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 412 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 452 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 39 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 79 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 795 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 835 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 456 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 496 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 44.0 bits (99), Expect = 3e-04 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGD 938 +HSPFR N KG R GP R Y SWR GD Sbjct: 3 SHSPFRLRNCGKGDRCGPLRYYASWRKGD 31 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 377 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 417 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 1111 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 1151 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 302 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 342 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 116 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 156 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 26 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 66 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 44.0 bits (99), Expect = 3e-04 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -2 Query: 1024 AHSPFRXXNXWKGXRXGPFRXYXSWRXGD 938 +HSPFR N KG R GP R Y SWR GD Sbjct: 3 SHSPFRLRNCGKGDRCGPLRYYASWRKGD 31 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 492 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 532 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 100 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 140 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 60 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 100 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 62 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 102 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 56 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 96 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 161 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 201 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -1 Query: 992 ERXSVRAFSXXXQLAKXGXXQGXLSWVRQGFPKSXRCKTXA 870 E SVRA S QLAK G LSWV GF +S RCKT A Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,942,970 Number of Sequences: 59808 Number of extensions: 600748 Number of successful extensions: 12925 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10032 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5058981887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -