BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E04_e413_10.seq (1530 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 25 1.5 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 6.0 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 25.0 bits (52), Expect = 1.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 775 VEPVGALSAHVADALRSEVLLYSIHYVLIVLE 680 V+P G ++ DAL V Y + V +++E Sbjct: 142 VDPYGLVAQWATDALNPSVYTYEVSPVFVLME 173 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 6.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 512 EYNSQKERVVGCNNCQGTVGALRKKFDQTPYEDF 613 +Y V C++ GT GA+ KK YED+ Sbjct: 638 DYVPSGNSTVDCDDV-GTFGAILKKLLPKVYEDY 670 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 271,324 Number of Sequences: 336 Number of extensions: 5680 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45988825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -