BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E03_e405_09.seq (1525 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 26 0.64 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 4.5 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 4.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 4.5 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 23 6.0 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 23 7.9 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 7.9 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 26.2 bits (55), Expect = 0.64 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 112 IAIKKNNEIANASEAYEISPRSRVFYLS*LDKLSRTGQKMVFLFKTL 252 +A K+ ++ N A I+P++ ++ + KLSR +MV LF + Sbjct: 189 LAFKQRYQLINEQMAVRINPKNCASFVIEVRKLSRLLGEMVGLFNDI 235 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +1 Query: 283 CSRAVHQPALRGVSKPSPQLAALTPKVRAFVERSAALCQPDHVH 414 C QP + S LA +TP V + +++C P H Sbjct: 113 CESLNTQPPVTSSSNILQNLADITPNVTPNCDVKSSVCSPGSGH 156 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +1 Query: 283 CSRAVHQPALRGVSKPSPQLAALTPKVRAFVERSAALCQPDHVH 414 C QP + S LA +TP V + +++C P H Sbjct: 113 CESLNTQPPVTSSSNILQNLADITPNVTPNCDVKSSVCSPGSGH 156 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +1 Query: 283 CSRAVHQPALRGVSKPSPQLAALTPKVRAFVERSAALCQPDHVH 414 C QP + S LA +TP V + +++C P H Sbjct: 113 CESLNTQPPVTSSSNILQNLADITPNVTPNCDVKSSVCSPGSGH 156 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 858 PLPALCWYRERDTRLAXXPXXVPLSCT 938 P+P + +D +LA VP CT Sbjct: 61 PVPIIARQLNQDLKLASGDYTVPAGCT 87 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 473 PCCCISCNKAVASASE-PSHTCT*SG 399 P CI CNK+ + A+ +H T SG Sbjct: 21 PYRCIDCNKSFSQAANLTAHVRTHSG 46 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 473 PCCCISCNKAVASASE-PSHTCT*SG 399 P CI CNK+ + A+ +H T SG Sbjct: 277 PYRCIDCNKSFSQAANLTAHVRTHSG 302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 270,472 Number of Sequences: 336 Number of extensions: 5430 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45783975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -