BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E02_e397_10.seq (1523 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 25 2.3 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 24 4.0 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 24.6 bits (51), Expect = 2.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 261 LQNRQEQRNETLAARSEAGAQKIEAQGLLQDPGR 362 L +R RN L ++E+QG DPGR Sbjct: 109 LHSRLPGRNFNLLRADANSVNELESQGFNYDPGR 142 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 23.8 bits (49), Expect = 4.0 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +1 Query: 478 RFKEVGEAYGILSDPKKRARYDHGHLDEDGSGMPDI--DPN 594 RF+EV E YGIL + + R + + D P + DPN Sbjct: 60 RFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPN 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,877 Number of Sequences: 438 Number of extensions: 4374 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53352750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -