BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E01_e389_09.seq (1474 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 5e-18 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 85 2e-16 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 85 2e-16 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 85 2e-16 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 9e-15 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 70 4e-12 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 70 5e-12 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 70 5e-12 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 70 5e-12 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 69 7e-12 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 69 7e-12 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 69 7e-12 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 69 7e-12 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 69 7e-12 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 69 7e-12 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 69 7e-12 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 69 7e-12 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 69 7e-12 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 69 7e-12 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 69 7e-12 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 69 7e-12 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 69 7e-12 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 69 7e-12 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 69 7e-12 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 69 7e-12 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 69 7e-12 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 69 7e-12 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 69 7e-12 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 69 7e-12 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 69 7e-12 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 69 7e-12 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 69 7e-12 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 69 7e-12 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 69 7e-12 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 69 7e-12 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 69 7e-12 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 69 7e-12 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 69 7e-12 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 69 7e-12 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 69 7e-12 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 69 7e-12 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 69 7e-12 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 69 7e-12 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 69 7e-12 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 69 7e-12 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 69 7e-12 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 69 7e-12 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 69 7e-12 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 69 7e-12 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 69 7e-12 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 69 7e-12 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 69 7e-12 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 69 1e-11 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 68 2e-11 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 66 7e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 66 7e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 66 7e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 66 7e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 66 7e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 66 7e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 66 7e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 66 7e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 66 7e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 66 7e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 66 7e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 66 7e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 66 7e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 66 7e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 66 7e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 66 7e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 66 7e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 66 7e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 66 7e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 66 7e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 66 7e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 66 7e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 66 7e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 66 7e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 66 7e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 66 7e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 66 7e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 66 7e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 66 7e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 66 7e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 66 7e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 66 7e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 66 7e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 66 7e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 66 7e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 66 7e-11 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 66 7e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 66 7e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 66 7e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 66 7e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 66 7e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 66 7e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 66 7e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 66 7e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 66 7e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 66 7e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 66 7e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 66 7e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 66 7e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 66 7e-11 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 66 7e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 66 7e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 66 7e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 66 7e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 66 7e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 66 7e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 66 7e-11 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 66 9e-11 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 65 1e-10 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 65 2e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 65 2e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 65 2e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 65 2e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 65 2e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 65 2e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 65 2e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 65 2e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 65 2e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 65 2e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 65 2e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 65 2e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 65 2e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 65 2e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 65 2e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 89.8 bits (213), Expect = 5e-18 Identities = 39/61 (63%), Positives = 40/61 (65%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPVNCNTTHYRANWXPG 804 RNCW GRS KG CAARR+SWVTPGF VKRRPVNCNTTHYRANW Sbjct: 24 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANWSST 83 Query: 803 A 801 A Sbjct: 84 A 84 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 84.6 bits (200), Expect = 2e-16 Identities = 39/67 (58%), Positives = 40/67 (59%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPVNCNTTHYR 822 H P R RNCW GRS KG CAARR+SW GF VKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 821 ANWXPGA 801 ANW A Sbjct: 646 ANWSSTA 652 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 84.6 bits (200), Expect = 2e-16 Identities = 39/67 (58%), Positives = 40/67 (59%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPVNCNTTHYR 822 H P R RNCW GRS KG CAARR+SW GF VKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 821 ANWXPGA 801 ANW A Sbjct: 89 ANWSSTA 95 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 84.6 bits (200), Expect = 2e-16 Identities = 39/67 (58%), Positives = 40/67 (59%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPVNCNTTHYR 822 H P R RNCW GRS KG CAARR+SW GF VKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 821 ANWXPGA 801 ANW A Sbjct: 89 ANWSSTA 95 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 79.0 bits (186), Expect = 9e-15 Identities = 35/54 (64%), Positives = 37/54 (68%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRRFTRRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 74.1 bits (174), Expect = 3e-13 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRR RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 74.1 bits (174), Expect = 3e-13 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRR RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 74.1 bits (174), Expect = 3e-13 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRR RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 74.1 bits (174), Expect = 3e-13 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRR RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 74.1 bits (174), Expect = 3e-13 Identities = 33/54 (61%), Positives = 35/54 (64%) Frame = +1 Query: 847 TGRRFTRRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 TGRR RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -3 Query: 983 RNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVKRRPV 846 RNCW GRS KG CAARR+SWVTPGFSQSRR KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 70.1 bits (164), Expect = 4e-12 Identities = 32/60 (53%), Positives = 33/60 (55%) Frame = -3 Query: 1037 YXXLQNXXAXICHXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 Y N H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 204 YKNFFNTCKGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 263 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 69.7 bits (163), Expect = 5e-12 Identities = 32/60 (53%), Positives = 33/60 (55%) Frame = -3 Query: 1037 YXXLQNXXAXICHXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 Y L H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 359 YETLIGFKQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 418 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 69.7 bits (163), Expect = 5e-12 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK---RRPVNCNTT 831 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K + C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQV 78 Query: 830 HYRANWXPGA 801 R + PGA Sbjct: 79 DSRGSPFPGA 88 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 69.7 bits (163), Expect = 5e-12 Identities = 35/52 (67%), Positives = 36/52 (69%) Frame = -2 Query: 1002 PXAXQXAQLLXRAIGRAXSXXRQLXKRGMCCKANKLGNARVFPVTTCKTTAS 847 P A Q AQLL RAIG +RGMCCKA KLGNARVFPVTT KTTAS Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 519 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 693 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 334 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 602 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 226 Score = 61.7 bits (143), Expect = 1e-09 Identities = 28/46 (60%), Positives = 28/46 (60%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 RRDWEN GVTQL RLAAH PF DRP QQLR L G W Sbjct: 521 RRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 Score = 64.9 bits (151), Expect = 2e-10 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 RRDWENPGVTQL RLAAH PF DRP QQLR L G W Sbjct: 91 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 79 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 308 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 235 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 492 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 327 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 177 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 961 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 628 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 309 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 542 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 226 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = -1 Query: 1003 AIXXSGCATVGKGDRXGLFXIXPAGEKGXVLQGE 902 AI SGCATVGKGDR G + KG VLQG+ Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 68 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 115 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 69.3 bits (162), Expect = 7e-12 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISWVTPGFSQSRRVK 858 H P R RNCW GRS KG CAARR+SWVTPGFSQSRR K Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 68.5 bits (160), Expect = 1e-11 Identities = 38/88 (43%), Positives = 41/88 (46%) Frame = +1 Query: 739 TLNKLECSKRAQXXXXXTRGGAPGXQFAL**VVLQFTGRRFTRRDWENPGVTQLIRLAAH 918 T+NK+E + A QFAL RRDWENPGVTQL RLAAH Sbjct: 77 TVNKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAH 136 Query: 919 XPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 PF DRP QQLR L G W Sbjct: 137 PPFASWRNSEEARTDRPSQQLRSLNGEW 164 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 67.7 bits (158), Expect = 2e-11 Identities = 38/90 (42%), Positives = 42/90 (46%) Frame = +1 Query: 733 NFTLNKLECSKRAQXXXXXTRGGAPGXQFAL**VVLQFTGRRFTRRDWENPGVTQLIRLA 912 +FTL+ +E + A QFAL RRDWENPGVTQL RLA Sbjct: 20 SFTLSLIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLA 79 Query: 913 AHXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 AH PF DRP QQLR L G W Sbjct: 80 AHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) Length = 156 Score = 67.7 bits (158), Expect = 2e-11 Identities = 38/89 (42%), Positives = 41/89 (46%) Frame = +1 Query: 736 FTLNKLECSKRAQXXXXXTRGGAPGXQFAL**VVLQFTGRRFTRRDWENPGVTQLIRLAA 915 FTL+ +E + A QFAL RRDWENPGVTQL RLAA Sbjct: 29 FTLSPIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAA 88 Query: 916 HXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 H PF DRP QQLR L G W Sbjct: 89 HPPFASWRNSEEARTDRPSQQLRSLNGEW 117 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 66.5 bits (155), Expect = 5e-11 Identities = 38/95 (40%), Positives = 42/95 (44%) Frame = +1 Query: 718 SRWADNFTLNKLECSKRAQXXXXXTRGGAPGXQFAL**VVLQFTGRRFTRRDWENPGVTQ 897 +R D + K+E + A QFAL RRDWENPGVTQ Sbjct: 59 ARTGDLLRVRKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQ 118 Query: 898 LIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 L RLAAH PF DRP QQLR L G W Sbjct: 119 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 153 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 31 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 24 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 839 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 120 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 17 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 25 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 138 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 159 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 27 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 219 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 39 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 54 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 81 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 152 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 1196 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 47.2 bits (107), Expect = 3e-05 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = -3 Query: 1001 HXPXRXRNCWXGRSXGPXRYXASWXKGXCAARRISW 894 H P R RNCW GRS KG CAARR+SW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 131 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 83 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 102 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 67 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 27 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 30 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 114 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 30 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 82 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 97 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 47 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 1069 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 140 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 188 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 176 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 223 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 25 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 152 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 122 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 29 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 658 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 167 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 76 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 904 RLAAHXPFXQLAXXRXGPXDRPXQQLRXLXG 996 +++AH PF DRP QQLR L G Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNG 44 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 77 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 85 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 191 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 450 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 272 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 67 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 76 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 110 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 69 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 80 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 89 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 182 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 89 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.1 bits (154), Expect = 7e-11 Identities = 37/89 (41%), Positives = 40/89 (44%) Frame = +1 Query: 736 FTLNKLECSKRAQXXXXXTRGGAPGXQFAL**VVLQFTGRRFTRRDWENPGVTQLIRLAA 915 +T K+E + A QFAL RRDWENPGVTQL RLAA Sbjct: 21 YTWQKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAA 80 Query: 916 HXPFXQLAXXRXGPXDRPXQQLRXLXGXW 1002 H PF DRP QQLR L G W Sbjct: 81 HPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 148 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 74 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 50 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 87 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 197 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 93 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 110 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 47 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 132 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 61 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 24 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 60 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = +1 Query: 865 RRDWENPGVTQLIRLAAHXPFXQLAXXRXGPXDRPXQQLRXLXGXWQI 1008 RRDWENPGVTQL RLAAH PF DRP QQLR L G W++ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,333,986 Number of Sequences: 59808 Number of extensions: 624811 Number of successful extensions: 8127 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8048 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4753799685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -