BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_E01_e389_09.seq (1474 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p pro... 31 3.0 AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-P... 31 3.0 >BT021372-1|AAX33520.1| 2286|Drosophila melanogaster LP05745p protein. Length = 2286 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 565 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NISSVL 464 R+ FS + WNY CW C P+ R N++ +L Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362 >AE014134-3630|EAA46011.1| 2286|Drosophila melanogaster CG18140-PA protein. Length = 2286 Score = 31.5 bits (68), Expect = 3.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 565 RNNFSIRYWSWNYRGCWHQTCP--PIVPR*NISSVL 464 R+ FS + WNY CW C P+ R N++ +L Sbjct: 327 RHGFSGLHLDWNYPKCWQSDCSRGPVTDRPNLTKLL 362 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,788,616 Number of Sequences: 53049 Number of extensions: 914025 Number of successful extensions: 1943 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1942 length of database: 24,988,368 effective HSP length: 88 effective length of database: 20,320,056 effective search space used: 8168662512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -