BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D12_e476_08.seq (1538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 27 0.57 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 9.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 9.3 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 26.6 bits (56), Expect = 0.57 Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 463 FYYMDMNVYTIPTP-NVQFLKFHLCTKRFFKXII 561 FY D NVY +P P N +F ++ + + + + ++ Sbjct: 228 FYNDDANVYILPDPYNTKFFRYRITPELYSEHLV 261 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 9.3 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 717 FYSXXTXEMXAXIALYYLKKCIDIYSQEXIIMK--ITHXGYIF 839 +Y EM A L+Y K DI+ + + K I YI+ Sbjct: 100 YYPQLLREMSALFKLFYHAKDFDIFFKTALWAKNNINEAQYIY 142 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 9.3 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 717 FYSXXTXEMXAXIALYYLKKCIDIYSQEXIIMK--ITHXGYIF 839 +Y EM A L+Y K DI+ + + K I YI+ Sbjct: 100 YYPQLLREMSALFKLFYHAKDFDIFFKTALWAKNNINEAQYIY 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 300,578 Number of Sequences: 438 Number of extensions: 5856 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53950875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -