BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D11_e468_07.seq (1465 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac... 27 8.6 >SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 26.6 bits (56), Expect = 8.6 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -3 Query: 389 LKTAISSLKDSEEQTSPPATPGSRGVHVASSHFSKIRA 276 L I LK EE +PP P + HF K+ A Sbjct: 150 LVNTIEKLKVKEENEAPPVIPAKPFSSSSEQHFRKVPA 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,790,316 Number of Sequences: 5004 Number of extensions: 37198 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 814673514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -