SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_D11_e468_07.seq
         (1465 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac...    27   8.6  

>SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit
           Vps23|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 487

 Score = 26.6 bits (56), Expect = 8.6
 Identities = 13/38 (34%), Positives = 16/38 (42%)
 Frame = -3

Query: 389 LKTAISSLKDSEEQTSPPATPGSRGVHVASSHFSKIRA 276
           L   I  LK  EE  +PP  P       +  HF K+ A
Sbjct: 150 LVNTIEKLKVKEENEAPPVIPAKPFSSSSEQHFRKVPA 187


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,790,316
Number of Sequences: 5004
Number of extensions: 37198
Number of successful extensions: 76
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 76
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 76
length of database: 2,362,478
effective HSP length: 76
effective length of database: 1,982,174
effective search space used: 814673514
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -