BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D08_e444_08.seq (1556 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 4.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 5.9 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 25.4 bits (53), Expect = 4.5 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 203 NLVRDSPLVCIQLLIGYTLPTHSFHRVHTVSVVRIYQTWYQXLV 72 NL+ L+ L+G+TLP S ++ + + QT + LV Sbjct: 237 NLIVPCVLISSMALLGFTLPPDSGEKLTLGLTILVSQTVFSLLV 280 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 896 VPHQXGRPVSPTGLPAGNRERFPPL 822 +P GR +SP+ AG R PP+ Sbjct: 668 LPSATGRDISPSASAAGLTTRSPPI 692 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,316,599 Number of Sequences: 2352 Number of extensions: 25363 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 183284145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -