BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D07_e436_07.seq (1488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 26 0.72 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 26 0.72 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 8.9 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 8.9 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 26.2 bits (55), Expect = 0.72 Identities = 27/110 (24%), Positives = 48/110 (43%) Frame = +1 Query: 241 AIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEYQQYQDATAED 420 A+QE +R E+ + + LH M EAE V + + Y++A + Sbjct: 179 AVQEERQRTKERDQSEVESTSSLH----SDMPIERILEAEKRVECKMEQQGNYENAVSHI 234 Query: 421 DTEFDQEDMEELAQDEHHD*IGSIPPIYEILLLKNMVNKYFIVVFHSSHR 570 +++ + +A +H S+P ++LLL+ N+ I F SHR Sbjct: 235 CNATNKQLFQLVAWAKHIPHFTSLPLEDQVLLLRAGWNELLIASF--SHR 282 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 26.2 bits (55), Expect = 0.72 Identities = 27/110 (24%), Positives = 48/110 (43%) Frame = +1 Query: 241 AIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEYQQYQDATAED 420 A+QE +R E+ + + LH M EAE V + + Y++A + Sbjct: 179 AVQEERQRTKERDQSEVESTSSLH----SDMPIERILEAEKRVECKMEQQGNYENAVSHI 234 Query: 421 DTEFDQEDMEELAQDEHHD*IGSIPPIYEILLLKNMVNKYFIVVFHSSHR 570 +++ + +A +H S+P ++LLL+ N+ I F SHR Sbjct: 235 CNATNKQLFQLVAWAKHIPHFTSLPLEDQVLLLRAGWNELLIASF--SHR 282 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 8.9 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +1 Query: 499 IYEILLLKNMVNKYFIVVFHSSHRWMPSLIN 591 IY++ ++ ++ + V H+ WMP+ +N Sbjct: 790 IYKVGNVQAYIDGNVVFVCHNGMNWMPTHLN 820 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.6 bits (46), Expect = 8.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 334 DEMEFNEAESNVNDLVSEYQQYQDATAEDDT 426 DE F+E +S + +S + +Y D+ + +T Sbjct: 206 DERSFSEHDSVMLGEISPHHEYYDSKSSTET 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 295,686 Number of Sequences: 438 Number of extensions: 5646 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 51917250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -