BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D04_e412_08.seq (1545 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 116 1e-24 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 116 1e-24 UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 114 5e-24 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 105 3e-21 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 77 2e-12 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 76 3e-12 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 66 2e-09 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 58 5e-07 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 56 2e-06 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 54 1e-05 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 51 7e-05 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 47 0.001 UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera... 42 0.033 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 42 0.043 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 41 0.10 UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forse... 40 0.13 UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; ... 40 0.23 UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barre... 39 0.40 UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barre... 38 0.71 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 37 1.2 UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flav... 37 1.6 UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|... 36 2.9 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 2.9 UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiel... 36 3.8 UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flav... 35 5.0 UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae ba... 35 6.6 UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megat... 35 6.6 UniRef50_UPI0000F2C3E7 Cluster: PREDICTED: hypothetical protein;... 34 8.7 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 116 bits (280), Expect = 1e-24 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 77 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 116 bits (280), Expect = 1e-24 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 114 bits (275), Expect = 5e-24 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEW 119 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 105 bits (252), Expect = 3e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 700 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 76.6 bits (180), Expect = 2e-12 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 L +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 15 LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 75.8 bits (178), Expect = 3e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 555 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 659 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISE 39 Score = 35.1 bits (77), Expect = 5.0 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 653 SEEARTDRPSQQLRSL 700 SEEARTDRPSQQLRSL Sbjct: 38 SEEARTDRPSQQLRSL 53 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 66.1 bits (154), Expect = 2e-09 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = +2 Query: 557 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 LA +L R DW+NP +T +NRL +H P WR+++ AR PS + SL+GEW Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEW 69 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 58.4 bits (135), Expect = 5e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +2 Query: 566 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 706 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+G Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDG 63 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 56.0 bits (129), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +2 Query: 644 WRNSEEARTDRPSQQLRSLNGEWXIV 721 WRNSEEARTDRPSQQLRSLNGEW ++ Sbjct: 47 WRNSEEARTDRPSQQLRSLNGEWRLM 72 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 54.0 bits (124), Expect = 1e-05 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +2 Query: 566 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ +SLNG+W Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK-KSLNGQW 54 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 51.2 bits (117), Expect = 7e-05 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 712 PFAIQAAQLLGRAIGAGLFAITPAGERG 629 PFAIQAAQLLGRAIGAGLFAITP E G Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 47.2 bits (107), Expect = 0.001 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 575 RRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEW 712 + DWENP V Q+NRL A S+ E+A T DR ++SLNG+W Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSLNGQW 77 >UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera araneosa HTCC2155|Rep: Beta-D-galactosidase - Lentisphaera araneosa HTCC2155 Length = 991 Score = 42.3 bits (95), Expect = 0.033 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +2 Query: 584 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 WENP LN LA PP S+ + E+A S + SLNG W Sbjct: 6 WENPQFVSLNTLAPRPPLYSFDSLEKALEQDQSAYIHSLNGSW 48 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 41.9 bits (94), Expect = 0.043 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 566 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 712 +L +DW+NP + + + H P S+R +EAR D + +SLNG+W Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLDVGGNR-QSLNGQW 54 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 40.7 bits (91), Expect = 0.10 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = +2 Query: 578 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDR--PSQQLRSLNGEW 712 R+WEN +TQ+NR H P+ ++ + E+A + S+ ++SL+G W Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIW 49 >UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forsetii KT0803|Rep: Beta-galactosidase - Gramella forsetii (strain KT0803) Length = 1049 Score = 40.3 bits (90), Expect = 0.13 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 581 DWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 712 DWENP VT +N+L A S+ N + A S +++SLNG W Sbjct: 26 DWENPAVTGINKLPARATMYSFSNKQAAINLNKENSDRVKSLNGTW 71 >UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 1046 Score = 39.5 bits (88), Expect = 0.23 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 572 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEWXIV 721 Q +WENP + N+ H F + +E+A D+P S SLNG W + Sbjct: 26 QNNEWENPAKYEWNKERPHADFRLYEQAEDAVNDKPRKSSWQHSLNGVWKFI 77 >UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Acidobacteria bacterium Ellin345|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Acidobacteria bacterium (strain Ellin345) Length = 1049 Score = 38.7 bits (86), Expect = 0.40 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 572 QRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEW 712 Q DWENP V +NR A F + + A R ++PS ++SLNG W Sbjct: 21 QTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSVFMQSLNGMW 69 >UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1045 Score = 37.9 bits (84), Expect = 0.71 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 581 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEW 712 DW+NP V +N+ A F + + + D P SQ SLNGEW Sbjct: 11 DWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEW 56 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 37.1 bits (82), Expect = 1.2 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 504 RGGARYPIRPIVSRIT 551 RGGARYPIRPIVSRIT Sbjct: 260 RGGARYPIRPIVSRIT 275 >UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Beta-galactosidase precursor - Flavobacterium johnsoniae UW101 Length = 1108 Score = 36.7 bits (81), Expect = 1.6 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 584 WENPGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQQLRSLNGEW 712 WE+P +T +NR + S+ + E+A + DR +++ LNG+W Sbjct: 57 WEDPTITSINRQPSRATAYSYSSVEDALKGDRTKSRIQMLNGDW 100 >UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|Rep: Beta-galactosidase - Bacteroides thetaiotaomicron Length = 1036 Score = 35.9 bits (79), Expect = 2.9 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = +2 Query: 581 DWENPGVTQLNRLAAHPPFASWRNSEEAR--TDRPSQQLRSLNGEW 712 +W++P V +NR A H + ++ +++EA+ + SQ +LNG W Sbjct: 26 EWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLW 71 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 2.9 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 566 VLQRRDWENPGVTQLNRLAAHPP 634 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiella blandensis MED217|Rep: Beta-galactosidase - Leeuwenhoekiella blandensis MED217 Length = 1033 Score = 35.5 bits (78), Expect = 3.8 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 572 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEW 712 Q+ +WENP + N+ F + +++A+T SQ +SLNG W Sbjct: 20 QQNEWENPKIIDRNKEEGRASFVLFEKTQKAKTRDASQSQFYKSLNGVW 68 >UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flavobacterium|Rep: Beta-galactosidase precursor - Flavobacterium sp. 4214 Length = 1046 Score = 35.1 bits (77), Expect = 5.0 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 575 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTD--RPSQQLRSLNGEW 712 R DWENP V Q+NR A F + + A D S SL+G+W Sbjct: 28 RNDWENPEVFQINREPARAAFLPFADEASAIADDYTRSPWYMSLDGKW 75 >UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae bacterium TAV2|Rep: Beta-galactosidase - Opitutaceae bacterium TAV2 Length = 1130 Score = 34.7 bits (76), Expect = 6.6 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 584 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR--SLNGEW 712 WE P +T LN+L F + + +EAR + + R SLNG W Sbjct: 10 WEAPELTSLNKLPPRATFHGFGSVKEARAGKSEKSTRHHSLNGTW 54 >UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megaterium|Rep: Beta-galactosidase - Bacillus megaterium Length = 1034 Score = 34.7 bits (76), Expect = 6.6 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 581 DWEN-PGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQ-QLRSLNGEW 712 +W N P + QLNR AH ++ EEA + DR S +SLNG W Sbjct: 19 EWNNNPEIFQLNRSKAHALLMPYQTVEEALKNDRKSSVYYQSLNGSW 65 >UniRef50_UPI0000F2C3E7 Cluster: PREDICTED: hypothetical protein; n=2; Theria|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 411 Score = 34.3 bits (75), Expect = 8.7 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -3 Query: 187 SPPADRAVRLS--REPL-EPGPPIQRESTGNAYRRPLVADLVPNXLQPGGXH*XLERPPP 17 SP A++A L REP EPGP +E+TG+A +P GG +R PP Sbjct: 247 SPAAEQASELGSEREPEPEPGPARSQEATGSAASAAQPCPALPTCRHRGGVPGSPQRTPP 306 Query: 16 R 14 R Sbjct: 307 R 307 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,085,234,463 Number of Sequences: 1657284 Number of extensions: 20370020 Number of successful extensions: 45145 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 43041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45109 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 165344584750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -