BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D04_e412_08.seq (1545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 3.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 8.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 630 PLSPAGVIAKRPAPIALPNSCA 695 P P GV KR P AL +CA Sbjct: 52 PCPPQGVDLKRVLPEALQTNCA 73 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 8.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -3 Query: 151 EPLEPGPPIQRESTGNAYRRPLVADLVPNXLQPGGXH*XLER 26 +P EPG + NAY R ++ +L GG H ER Sbjct: 1101 QPCEPGQYVPDPHNCNAYYRCVLGELRKQYC-AGGLHWNKER 1141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,242 Number of Sequences: 336 Number of extensions: 4805 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46500950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -