BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D04_e412_08.seq (1545 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0416 - 17399059-17399777,17400560-17400704 31 1.8 09_02_0036 + 3217163-3217584,3217752-3218322 30 4.3 01_05_0416 + 21956050-21956512,21958001-21958065,21958772-219589... 30 5.6 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 29 7.5 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 29 7.5 06_03_0400 - 20420257-20421837 29 9.9 >09_04_0416 - 17399059-17399777,17400560-17400704 Length = 287 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 829 PEIGLSGCSSLEQESTIKRTWTXTSRGEKPSSGRWPLREP 948 P +G G S E+ + R+W GE+ ++ RW R P Sbjct: 184 PRVGQEGRPSKEEIRGVDRSWKKREAGEEGAAARWGERPP 223 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 546 ITIHWPSFYNVV-TGKTLALPNLIALQH 626 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >01_05_0416 + 21956050-21956512,21958001-21958065,21958772-21958933, 21959006-21959107 Length = 263 Score = 29.9 bits (64), Expect = 5.6 Identities = 24/88 (27%), Positives = 38/88 (43%) Frame = -3 Query: 313 RELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQLWVVQSPPADRAVRLSREPLEPG 134 ++L L +R + HRS+ ++ G S + L +SP R SR P Sbjct: 2 QQLRLRLNTKAQHRRGKTHRSKLGTKIGPHSHRAHEALARHKSPDFRRTGPPSRTNTSPQ 61 Query: 133 PPIQRESTGNAYRRPLVADLVPNXLQPG 50 PP ++ST + RRP + +PG Sbjct: 62 PP--KDSTARSGRRPTEGRSITEGRRPG 87 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 29.5 bits (63), Expect = 7.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 608 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 706 L+R + PF SW N +A D+ + L LNG Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 431 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 29.5 bits (63), Expect = 7.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 608 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 706 L+R + PF SW N +A D+ + L LNG Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 436 >06_03_0400 - 20420257-20421837 Length = 526 Score = 29.1 bits (62), Expect = 9.9 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = -3 Query: 244 PSRRGMKSGIEYHQLWVVQSPPADRAVRLSREPLEPGPPIQRESTGNAYRRPLVADLVPN 65 P R+GM I+Y W + PA+ ++ R+ P ++ AY DL N Sbjct: 414 PHRKGMLYNIQYITFWFGEGAPAEAPIKWIRDFYAFMEPYVTKNPRQAYVNYRDLDLGVN 473 Query: 64 XLQPG 50 ++ G Sbjct: 474 AVEAG 478 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,947,485 Number of Sequences: 37544 Number of extensions: 603748 Number of successful extensions: 1390 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1390 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4977304332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -