BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D03_e404_07.seq (1596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 71 2e-14 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 6.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 8.3 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 70.9 bits (166), Expect = 2e-14 Identities = 42/112 (37%), Positives = 64/112 (57%), Gaps = 7/112 (6%) Frame = +3 Query: 411 EVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQT 590 EV V+G + P PI FE + ++ + +K GY PT IQ P+ +SG++L+ AQT Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMSCAQT 204 Query: 591 GXGKTLAYILPAIVHI--NNQPP-----IPAVVMVLLH*XXAPTRELAHXIS 725 G GKT A++LP I ++ + PP V+V++ +PTRELA I+ Sbjct: 205 GSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIM----SPTRELAIQIA 252 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.0 bits (47), Expect = 6.3 Identities = 13/61 (21%), Positives = 30/61 (49%) Frame = -2 Query: 470 VCLFKMFNRIRYFNSTNSDFVFVSIVLYFIW*PIQD*FMRIIKIFVKWLERQRIPIRASH 291 +C++ +FN+ F S ++ VF+ ++ + + + +FVK + + I+ S Sbjct: 55 LCIWSIFNKWNQFRSYSNFSVFLFDIITIVTLTSTSILLIVNAVFVKEKRIRTLLIKLSE 114 Query: 290 I 288 I Sbjct: 115 I 115 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 530 YRGRIFVTHTFYCLTHIIWKVCLFKMFNRIRYF 432 Y+G + TF CL I W+ L + R + Sbjct: 519 YKGGKYRKVTFQCLKSIAWRAFLAVLKRRTEIY 551 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,360 Number of Sequences: 336 Number of extensions: 4139 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48242175 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -