BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D03_e404_07.seq (1596 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 5e-24 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 87 5e-17 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 83 6e-16 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 73 5e-13 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-10 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 64 4e-10 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 60 4e-09 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 60 5e-09 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 56 8e-08 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 54 4e-07 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 51 3e-06 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 51 3e-06 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 51 3e-06 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 50 5e-06 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 50 7e-06 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 46 1e-04 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 40 0.006 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 40 0.007 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 39 0.013 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 38 0.017 SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) 35 0.16 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 35 0.16 SB_19264| Best HMM Match : DUF1224 (HMM E-Value=6.2) 32 1.1 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 29 7.8 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 109 bits (263), Expect = 5e-24 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 2/143 (1%) Frame = +3 Query: 300 PNWDSLSLQPFNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPD 479 P + +PFNK+FY H + +S E++D R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 480 YVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIP 659 + +I+ + Y PT IQ Q PIA+SG++++G+A+TG GKT A++ PA+VHI +QP + Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQ 586 Query: 660 A--VVMVLLH*XXAPTRELAHXI 722 +VL+ APTREL I Sbjct: 587 VGDGPIVLI---CAPTRELCQQI 606 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 86.6 bits (205), Expect = 5e-17 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 3/112 (2%) Frame = +3 Query: 396 YRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLV 575 +R ++ G +P PI ++EA PD + + + +GYKDPTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 576 GVAQTGXGKTLAYILPAIVHINNQPPIPA---VVMVLLH*XXAPTRELAHXI 722 GVA+TG GKT A+ +P +V I P I APTRELA I Sbjct: 143 GVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQI 194 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 83.0 bits (196), Expect = 6e-16 Identities = 45/132 (34%), Positives = 70/132 (53%), Gaps = 1/132 (0%) Frame = +3 Query: 330 FNKDFYNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMG 509 F +Y+ ++ V S V++ R K+ + + G + P PIE F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 510 YKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPI-PAVVMVLLH* 686 ++ PTPIQ Q MSG++++G+A+TG GKTLAY LP + + + P P V L Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVAL-- 149 Query: 687 XXAPTRELAHXI 722 PTREL + Sbjct: 150 ILTPTRELMQQV 161 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 73.3 bits (172), Expect = 5e-13 Identities = 54/162 (33%), Positives = 73/162 (45%), Gaps = 1/162 (0%) Frame = +3 Query: 372 RSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPI 551 R +EV+ YR ++TV+G VP P+ FEE+ FPDY+ K G+ +PT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ---- 112 Query: 552 AMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPI-PAVVMVLLH*XXAPTRELAHXISR 728 +ILP IVHIN+QP + P ++L PTRELA + Sbjct: 113 --------------------FILPGIVHINHQPLLQPGDGPIVL--VLCPTRELAQQVQE 150 Query: 729 LLQXCXXXLXSPSMCVWRXPLKXNXSXXLERGXXNCXXXXPG 854 + S C++ K LERG C PG Sbjct: 151 VAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEIC-IATPG 191 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 72.1 bits (169), Expect = 1e-12 Identities = 42/101 (41%), Positives = 54/101 (53%) Frame = +3 Query: 420 VSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXG 599 VSG P I F E F + + I GY+ PTP+Q PI M+G++L+ AQTG G Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 600 KTLAYILPAIVHINNQPPIPAVVMVLLH*XXAPTRELAHXI 722 KT AY+LP + + Q + A L APTRELA I Sbjct: 529 KTAAYMLPVLTSLIKQ-GLNAPPRSPLALCVAPTRELAKQI 568 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 65.7 bits (153), Expect = 1e-10 Identities = 31/78 (39%), Positives = 45/78 (57%) Frame = +3 Query: 411 EVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQT 590 EV VSG I FEEAN + ++ YK PTP+Q PI ++G++++ AQT Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 757 Query: 591 GXGKTLAYILPAIVHINN 644 G GKT A++LP + + N Sbjct: 758 GSGKTAAFLLPVMTSMMN 775 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 64.1 bits (149), Expect = 3e-10 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 1/90 (1%) Frame = +3 Query: 324 QPFNKDFYNPHKSVLDRSPYEVEDYRNKHE-VTVSGVEVPNPIEHFEEANFPDYVCQAIK 500 QPF KDFY + +P E +++R E + V G P P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 501 SMGYKDPTPIQAQGWPIAMSGKNLVGVAQT 590 Y+ PTPIQAQ P+ MSG++++ + T Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIAIVMT 151 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 63.7 bits (148), Expect = 4e-10 Identities = 29/88 (32%), Positives = 50/88 (56%) Frame = +3 Query: 345 YNPHKSVLDRSPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPT 524 Y H ++ + +V+ R+K E+ V G V +P+ F +F + + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 525 PIQAQGWPIAMSGKNLVGVAQTGXGKTL 608 PIQ Q P+ +SG++++ A TG GK L Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGSGKLL 248 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 60.5 bits (140), Expect = 4e-09 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = +3 Query: 489 QAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVV 668 +A+ +G+ PTPIQA P+A+ GK++ A TG GKT A++LP + + +P + Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAI 82 Query: 669 MVLLH*XXAPTRELA 713 VL+ PTRELA Sbjct: 83 RVLV---ITPTRELA 94 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 60.1 bits (139), Expect = 5e-09 Identities = 33/96 (34%), Positives = 52/96 (54%) Frame = +3 Query: 447 IEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPA 626 +E F + + G+ PT IQ QG P+A+SG++++G A+TG GKTLA+++P Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPI 108 Query: 627 IVHINNQPPIPAVVMVLLH*XXAPTRELAHXISRLL 734 I + Q + L +PTRELA+ +L Sbjct: 109 IETLWRQKWTSMDGLGAL--VISPTRELAYQTFEVL 142 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 56.0 bits (129), Expect = 8e-08 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +3 Query: 411 EVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQT 590 EV VSG I FEEAN + ++ YK PTP+Q PI ++G++++ AQT Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 180 Query: 591 GXGKT 605 G GKT Sbjct: 181 GSGKT 185 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 55.2 bits (127), Expect = 1e-07 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +3 Query: 447 IEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPA 626 I FE+ + + + + GYK PTP+Q PI ++L+ AQTG GKT A+++P Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPI 933 Query: 627 IVHINNQ-PPIP 659 + I + PP P Sbjct: 934 LSRIYMEGPPAP 945 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +3 Query: 396 YRNKHEVTVSGVEVPNPIEHF----EEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSG 563 +R++ + V G +VP+P+E F E FPDY+ ++ GY PTPIQ Q P+ G Sbjct: 141 FRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPLMAHG 200 Query: 564 KNLVG 578 G Sbjct: 201 PKKSG 205 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 50.8 bits (116), Expect = 3e-06 Identities = 27/75 (36%), Positives = 39/75 (52%) Frame = +3 Query: 411 EVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQT 590 EV + G P P + F +Y + +G PT +Q WP + G+++ GVA Sbjct: 178 EVLIQGESAPRPFLTMNNSTFYEYGPR----LGVTVPTSLQKHMWPSLLRGRDVAGVAIE 233 Query: 591 GXGKTLAYILPAIVH 635 G GK LAY+LP I+H Sbjct: 234 GSGKRLAYLLP-IIH 247 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +3 Query: 456 FEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVH 635 FE+ + I G+ P+PIQ + P+A++G++++ A+ G GKT AY++P + Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 636 IN-NQPPIPAVVMVLLH*XXAPTRELAHXISRL 731 + + I A+V+V PTRELA S++ Sbjct: 109 TDTTKNCIQALVLV-------PTRELALQTSQI 134 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +3 Query: 456 FEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVH 635 FE+ + I G+ P+PIQ + P+A++G++++ A+ G GKT AY++P + Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 636 IN-NQPPIPAVVMVLLH*XXAPTRELAHXISRL 731 + + I A+V+V PTRELA S++ Sbjct: 109 TDTTKNCIQALVLV-------PTRELALQTSQI 134 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 50.0 bits (114), Expect = 5e-06 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 5/116 (4%) Frame = +3 Query: 405 KHEVTVSGVEVPNPI---EHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIAMSGK--N 569 KHEV V + +P+ + FEE + + + MG+ P+ IQ P+ ++ N Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVN 144 Query: 570 LVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLLH*XXAPTRELAHXISRLLQ 737 ++ +Q+G GKT A++L + ++ P P V+ + +PT ELA ++ + Sbjct: 145 MIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICL------SPTYELARQTGKVAE 194 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 49.6 bits (113), Expect = 7e-06 Identities = 31/76 (40%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = +3 Query: 501 SMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQP-PIPAVVMVL 677 +MG K PT IQ P + G++ +G A+TG GKT A+ LP + + + P I AVV+ Sbjct: 24 AMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVL-- 81 Query: 678 LH*XXAPTRELAHXIS 725 PTRELA I+ Sbjct: 82 -----TPTRELAFQIA 92 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 49.2 bits (112), Expect = 9e-06 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 474 PDYVCQAIKSMGYKDPTPIQAQGWPIAMS-GKNLVGVAQTGXGKTLAYILPAIVHI 638 PD + +A+ G+ PTPIQ+ P A+ ++++G A+TG GKTLA+ +P I HI Sbjct: 139 PD-ILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQHI 193 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 46.8 bits (106), Expect = 5e-05 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +3 Query: 489 QAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAI 629 Q IK MG+ T IQ + + G++L+G A+TG GKTLA+++P + Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVV 631 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 45.6 bits (103), Expect = 1e-04 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 4/86 (4%) Frame = +3 Query: 489 QAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVV 668 + +K MG P PIQ + P S K+L+ ++TG GK+L ++LP++ Q P Sbjct: 173 EKLKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPSV-----QDPGRGYG 227 Query: 669 MVLLH*XXAPTRELA----HXISRLL 734 +++ PTRELA + +SRLL Sbjct: 228 TIIV----VPTRELASQMLYEVSRLL 249 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = +3 Query: 546 PIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLLH*XXAPTRELA 713 P+ M GK++V +A+TG GKT A+++P + + ++L +PTRELA Sbjct: 313 PLVMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALIL----SPTRELA 364 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/76 (27%), Positives = 43/76 (56%) Frame = +3 Query: 507 GYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLLH* 686 G++ P+ IQ + + G++++ AQ+G GKT + + + I+ Q P +++ Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVL---- 71 Query: 687 XXAPTRELAHXISRLL 734 +PTRELA+ I +++ Sbjct: 72 --SPTRELANQIQKVV 85 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 39.9 bits (89), Expect = 0.006 Identities = 19/75 (25%), Positives = 41/75 (54%) Frame = +3 Query: 489 QAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVV 668 + + G++ P+PIQ + P+ G +L+ A++G GKT + + A+ ++ + ++ Sbjct: 26 RGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQII 85 Query: 669 MVLLH*XXAPTRELA 713 ++ PTRE+A Sbjct: 86 IL------TPTREIA 94 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = +3 Query: 477 DYVCQAIKSMGYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVH 635 D V +A+ ++ PT IQ P + +++ AQTG GKTLAY+ P +VH Sbjct: 387 DDVLKALDALNIHQPTVIQMVTIPKIIHRHHVICAAQTGSGKTLAYLAP-LVH 438 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 38.7 bits (86), Expect = 0.013 Identities = 22/66 (33%), Positives = 34/66 (51%) Frame = +3 Query: 525 PIQAQGWPIAMSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLLH*XXAPTR 704 PIQA + G++++G A+TG GKTL++ LP + + + APTR Sbjct: 98 PIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTR 157 Query: 705 ELAHXI 722 ELA + Sbjct: 158 ELAKQV 163 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 38.3 bits (85), Expect = 0.017 Identities = 28/102 (27%), Positives = 47/102 (46%) Frame = +3 Query: 375 SPYEVEDYRNKHEVTVSGVEVPNPIEHFEEANFPDYVCQAIKSMGYKDPTPIQAQGWPIA 554 +P + E +N TV+ + P+E P V +A+ +G+ Q Q Sbjct: 481 APEDDEFLKNLSLDTVAQMAAGIPVE----TETPPEVYKALGQLGFSSFRAGQEQAVMRI 536 Query: 555 MSGKNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLL 680 +SG + + V TG GK+L Y LPA ++ P + V+ L+ Sbjct: 537 LSGMSSLVVLSTGAGKSLCYQLPAYMYHKRSPCLTLVISPLV 578 >SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) Length = 304 Score = 35.1 bits (77), Expect = 0.16 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +3 Query: 432 EVPNPIE--HFEEANFPDYVCQAIKSM-GYKDPTPIQAQGWPIAMSGKNLVGVAQTGXGK 602 EV PI + E D A++ + GY D P+Q Q ++ K+ + + TG GK Sbjct: 108 EVAPPINTANIETDGSDDRALHALQHVFGYIDFRPMQRQAIDTLLAEKDSLILLPTGAGK 167 Query: 603 TLAYILPAIV 632 T+ Y +PA++ Sbjct: 168 TICYAIPALL 177 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 35.1 bits (77), Expect = 0.16 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +3 Query: 564 KNLVGVAQTGXGKTLAYILPAIVHINNQPPIPAVVMVLLH*XXAPTRELAHXIS 725 K+++G+A+TG GKT A+ LP + + + P ++L PTRELA IS Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQ-RLFALIL-----TPTRELAFQIS 49 >SB_19264| Best HMM Match : DUF1224 (HMM E-Value=6.2) Length = 256 Score = 32.3 bits (70), Expect = 1.1 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 461 RGKLSRLCVSSNKKYGLQRSYPYTGSRMANRYVREKLG--WCGPNRXRQNFGLYF 619 RGK ++S ++ L + PY S+ +N+ VRE L W P R Q FG+ + Sbjct: 60 RGKFEFFGINSPQRKELSK--PYLSSKFSNQEVREFLKELWSSPERELQYFGIAY 112 >SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 830 Score = 29.5 bits (63), Expect = 7.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 1405 PSPPXXXXPPPTXLPXXPXSXPXPAAXS 1488 PSPP PP P P S P AA S Sbjct: 309 PSPPNIAPSPPNTAPSPPHSDPIAAALS 336 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,698,258 Number of Sequences: 59808 Number of extensions: 507755 Number of successful extensions: 2976 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 2564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2919 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5235048542 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -