BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D01_e388_07.seq (1578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 30 0.041 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.50 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 1.5 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 6.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 30.3 bits (65), Expect = 0.041 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +3 Query: 444 ISEDLYDGQVLQKLLEVLTETKLDVPEVTQSEE---GQRQKLSVVLRAVNRVLYGTSKPV 614 + +D DG+ ++ E LTE K + ++T+SEE G V RA + ++G +PV Sbjct: 20 VFKDEGDGEDEKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHSPVFGKVEPV 79 Query: 615 PKWS 626 P S Sbjct: 80 PHTS 83 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.50 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 567 VLRAVNRVLYGTSKPVPK 620 +LR +NRVL G +KP PK Sbjct: 2181 LLRTINRVLRGYAKPDPK 2198 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -3 Query: 415 NSSLIQSINTCISSFTLGSSRDLGSIIALSSFSFKLYSS 299 NS I+ I + + SF L ++ D + +S+ +FK YS+ Sbjct: 73 NSIQIRCIESNMISFYLEATDDFAYFLEVSNNNFKTYSN 111 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 231 LVLPXCASCDL 199 LV+P C SCDL Sbjct: 208 LVMPLCKSCDL 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,994 Number of Sequences: 336 Number of extensions: 3916 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 47627625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -