BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_D01_e388_07.seq (1578 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces... 31 0.58 SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pom... 29 2.3 SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory sub... 27 7.1 SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter Atm1|S... 27 9.4 >SPCC1393.06c |||rRNA processing protein Ipi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 408 Score = 30.7 bits (66), Expect = 0.58 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = +3 Query: 378 LIQVLIDWINDELAPHRIIVKDISEDLYDGQVLQKLLEVLTETKLDVPEVTQSEEGQRQK 557 LI +I++I + + +VKD S +V + +L +L V V R+K Sbjct: 299 LIPGIIEFIRNSWSDACPVVKDGSNSPSASKVCRTVLSMLGLFTEQVFSVADEPNNHRKK 358 Query: 558 LSVVLRAVNR 587 +S VLR +NR Sbjct: 359 ISQVLRKINR 368 >SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +3 Query: 270 GSPTAPEIPPEEYSLNENEERAIIEPRSLEDPRVKELIQVLIDWINDELAPHRIIV 437 G P A E+PP+++ + ++ +A++EP+ LI LI WI D+ + I V Sbjct: 174 GRPVAFELPPDKF--HSDQSKALLEPKW---KTKNYLISHLIFWIIDQQSSSSIEV 224 >SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory subunit Ekc1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 838 Score = 27.1 bits (57), Expect = 7.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 309 SLNENEERAIIEPRSLEDPRV-KELIQVLIDWINDELAPH 425 S N NE +I P SL V ++ I L D++ D APH Sbjct: 234 SANSNEP-GVIGPNSLSRELVSRQTITTLTDYMTDSKAPH 272 >SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter Atm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 693 Score = 26.6 bits (56), Expect = 9.4 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -2 Query: 461 IQVFTDVFDDYSVRGQLIVDPIDQYLY 381 +++ +DV DD +V GQ+IV + QY++ Sbjct: 82 VKLASDVPDDKNVTGQMIVKDMLQYIW 108 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,900,404 Number of Sequences: 5004 Number of extensions: 63745 Number of successful extensions: 228 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 228 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 889996126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -