BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C11_e467_05.seq (1505 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosac... 28 3.9 >SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosaccharomyces pombe|chr 2|||Manual Length = 1172 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 92 RAALDHAVAVTRMVHRTKRQRWID-DVNHYGNAGT 193 R + +VA+T + H K WID H+G GT Sbjct: 920 RLEREKSVAITAINHLEKENDWIDGQKQHFGKQGT 954 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,241,247 Number of Sequences: 5004 Number of extensions: 71375 Number of successful extensions: 114 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 842423950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -