BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C11_e467_05.seq (1505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 2.5 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 7.5 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 2.5 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 185 AGTRRH-LTSPSHYTVKVPSDFSEHSRFTVN 274 AG RR LT + + +K P DF +HS +N Sbjct: 839 AGKRRPTLTESTSFELKKPKDFRKHSLLPLN 869 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.6 bits (51), Expect = 7.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 215 RVTSGGGASQRSHSGLRRRS 156 +++S GGAS +HSG RS Sbjct: 631 KLSSSGGASSTTHSGAPSRS 650 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,108,493 Number of Sequences: 2352 Number of extensions: 19269 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 176375430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -