BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C11_e467_05.seq (1505 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82085-7|CAB04988.1| 185|Caenorhabditis elegans Hypothetical pr... 30 4.9 Z92782-4|CAB07186.1| 367|Caenorhabditis elegans Hypothetical pr... 29 6.5 >Z82085-7|CAB04988.1| 185|Caenorhabditis elegans Hypothetical protein ZK218.8 protein. Length = 185 Score = 29.9 bits (64), Expect = 4.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 173 HYGNAGTRRHLTSPSHYTVKVPSDF 247 HY NAGT ++ S +YT+K+ + F Sbjct: 50 HYVNAGTIEYMASEYNYTIKIKNHF 74 >Z92782-4|CAB07186.1| 367|Caenorhabditis elegans Hypothetical protein F14F8.5 protein. Length = 367 Score = 29.5 bits (63), Expect = 6.5 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = -2 Query: 454 LTYFLQTSSTVPVSILWIYEIELINSLTEQLLEDSSTFIIVF 329 L++ + + P+S L +Y I+L NSL E +L D S + +VF Sbjct: 89 LSFCIPVTCIPPLSYLEMYFIQLFNSL-EIILTDLSVWFVVF 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,168,262 Number of Sequences: 27780 Number of extensions: 425854 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 4339584726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -