BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C11_e467_05.seq (1505 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 3.0 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 9.1 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.2 bits (50), Expect = 3.0 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 125 RMVHRTKRQRWIDDVNHYGNAGTRRHLTSPSHYTVKVPS 241 R T R+R D G +R H PSHY ++P+ Sbjct: 305 REYRETSRERSRD---RRGRGRSREHRIIPSHYIEQIPA 340 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 9.1 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 128 MVHRTKRQRWIDDVNHYGNAGTRRHLTSPSHYTVKVPSDFS 250 M++ W+ D+ Y NA +T + T+K D S Sbjct: 107 MLYVPSENIWLPDIVLYNNADGNYEVTLMTKATLKYTGDVS 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 309,987 Number of Sequences: 438 Number of extensions: 5994 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52635000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -