BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C08_e443_06.seq (1508 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 1.5 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 7.8 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 205 ASIQNYLNIMYCIKSIWDTRSSVITHCNLLFG*SPAIQE*FPSARIYI 62 A IQNY ++ + +WD ++T G S + PS Y+ Sbjct: 156 ADIQNYATLIKEFREVWDQHGLLLTAAVAAAGPSVDLSYHVPSLSKYL 203 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.6 bits (46), Expect = 7.8 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 390 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 271 T +IR +++ + + Y LCH + S T+R I Sbjct: 156 TRSIRLTITASCPMNLQYLPMDRQLCHIEIESFGYTMRDI 195 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,857 Number of Sequences: 336 Number of extensions: 3944 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45271850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -