BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C08_e443_06.seq (1508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 1.7 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 25 1.7 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 1.7 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 23 9.1 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 23 9.1 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 390 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 271 T +IR +++ + + YF LCH + S T+R I Sbjct: 127 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 166 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 390 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 271 T +IR +++ + + YF LCH + S T+R I Sbjct: 127 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 166 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 390 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 271 T +IR +++ + + YF LCH + S T+R I Sbjct: 66 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 105 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 261 KLCVYKVILLVY*LTNYIKPVYKI 190 K CV K I ++ Y++PVYK+ Sbjct: 70 KACVMKRIEMLKGTELYVEPVYKM 93 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 261 KLCVYKVILLVY*LTNYIKPVYKI 190 K CV K I ++ Y++PVYK+ Sbjct: 70 KACVMKRIEMLKGTELYVEPVYKM 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 261,761 Number of Sequences: 438 Number of extensions: 4994 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52754625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -