BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C07_e435_05.seq (1542 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99269-1|CAB16467.1| 1461|Caenorhabditis elegans Hypothetical pr... 58 2e-08 >Z99269-1|CAB16467.1| 1461|Caenorhabditis elegans Hypothetical protein W10C6.1 protein. Length = 1461 Score = 57.6 bits (133), Expect = 2e-08 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 5/109 (4%) Frame = +3 Query: 3 LFLGGGRATLGSSPGAVSALLAAFFPKFPTHSEDNRYHLQAFRHLYVLAVEPRLILPRDL 182 L LG GR +++ + + FP P DN ++ Q R L+ +AVEPRL++P D+ Sbjct: 1201 LMLGEGRYAFKKDDLSIALTIISTFPTIPQSVSDNSHYHQPLRFLWSMAVEPRLLVPFDI 1260 Query: 183 DTGKLCYTHIQLV-----DLEGVVTEMKAPCILPELERLREVRINDPRY 314 + + +V E +V + KAP +LP LE L+ + I Y Sbjct: 1261 AESCVVEVDVTIVMKPKDGNEPIVYKEKAPYLLPPLEDLQSISIGGGNY 1309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,123,608 Number of Sequences: 27780 Number of extensions: 257083 Number of successful extensions: 801 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4442168344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -