BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C07_e435_05.seq (1542 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05560.1 68418.m00604 E3 ubiquitin ligase, putative E3, ubiqu... 94 2e-19 >At5g05560.1 68418.m00604 E3 ubiquitin ligase, putative E3, ubiquitin ligase; contains similarity to Apc1/Tsg24 protein, the largest subunit of human anaphase-promoting complex (APC/C) GI:11967711 from [Homo sapiens] Length = 1678 Score = 94.3 bits (224), Expect = 2e-19 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 5/111 (4%) Frame = +3 Query: 3 LFLGGGRATLGSSPGAVSALLAAFFPKFPTHSEDNRYHLQAFRHLYVLAVEPRLILPRDL 182 LFLGGG T ++ G+++ LL +P+ P+ DNR HLQAFRHLYVLA E R + D+ Sbjct: 1367 LFLGGGMRTFSTNNGSLAMLLITLYPRLPSGPNDNRCHLQAFRHLYVLATEARWLQTIDV 1426 Query: 183 DTGKLCYTHIQLVDLE-GVVTEMK----APCILPELERLREVRINDPRYWP 320 D+G Y +++ E + +E K PCILPE L+ + + PRYWP Sbjct: 1427 DSGLPVYAPLEVTVKETKLYSETKFCEITPCILPERAILKRICVCGPRYWP 1477 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,535,401 Number of Sequences: 28952 Number of extensions: 246842 Number of successful extensions: 674 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4134955968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -