BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C05_e419_05.seq (1562 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46646| Best HMM Match : zf-AD (HMM E-Value=0.51) 31 3.3 SB_6305| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.096) 30 4.4 >SB_46646| Best HMM Match : zf-AD (HMM E-Value=0.51) Length = 287 Score = 30.7 bits (66), Expect = 3.3 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +2 Query: 281 DVQRFCACRTSLPPMQIATNDIYEXXXXXXXXXXXXXRVDSMESYGTNDSNPF 439 ++Q+ C +T+ PM++ T + E +S YG ND++ + Sbjct: 17 EIQQICEKKTTREPMRMNTENSREAASTTERSEGASGATNSQPHYGANDASDY 69 >SB_6305| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=0.096) Length = 155 Score = 30.3 bits (65), Expect = 4.4 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = -2 Query: 445 ESERI*IVRSITLHAVNSGTIIAVVTIVRGVL----VDVVCSYLHRR*RCTAG 299 E E I + R+ + ++GTI+AVV I+ V+ + V C Y R + TAG Sbjct: 53 EGEAIVLGRTSPDKSTSTGTIVAVVVILLAVILVIGIVVFCKYWRNRHQATAG 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,385,364 Number of Sequences: 59808 Number of extensions: 313403 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5105932995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -