BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C05_e419_05.seq (1562 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11279-1|AAW88399.1| 2886|Caenorhabditis elegans Sensory axon gu... 32 1.3 AY763581-1|AAV41897.1| 2914|Caenorhabditis elegans SAX-2 protein. 32 1.3 >U11279-1|AAW88399.1| 2886|Caenorhabditis elegans Sensory axon guidance protein 2,isoform a protein. Length = 2886 Score = 31.9 bits (69), Expect = 1.3 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 185 ETRIAKPLGIASRQRSSAHPPTVVQXDARAEIDVQRFC 298 +T+I KPL ++S Q P ++ DA+ ++D+ R C Sbjct: 556 DTQIGKPLMMSSIQNRGKEPDELISGDAKPKLDLFRTC 593 >AY763581-1|AAV41897.1| 2914|Caenorhabditis elegans SAX-2 protein. Length = 2914 Score = 31.9 bits (69), Expect = 1.3 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 185 ETRIAKPLGIASRQRSSAHPPTVVQXDARAEIDVQRFC 298 +T+I KPL ++S Q P ++ DA+ ++D+ R C Sbjct: 556 DTQIGKPLMMSSIQNRGKEPDELISGDAKPKLDLFRTC 593 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,059,345 Number of Sequences: 27780 Number of extensions: 225723 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4514820630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -