BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C04_e411_06.seq (1551 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0507 + 3655570-3655573,3655648-3655832 66 7e-11 10_08_0704 - 20018477-20018542,20018693-20018704,20018731-200189... 29 7.5 >06_01_0507 + 3655570-3655573,3655648-3655832 Length = 62 Score = 66.1 bits (154), Expect = 7e-11 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +3 Query: 315 GKLHGSLARAGKVKGQTPXXXXXXXXXXXXXXXXXXIQYNRRFVNVVQTFGRRRGPNSN 491 GK+HGSLARAGKV+GQTP +QYNRRFV V FG++RGPNS+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 >10_08_0704 - 20018477-20018542,20018693-20018704,20018731-20018927, 20018928-20018999,20019159-20021289 Length = 825 Score = 29.5 bits (63), Expect = 7.5 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 138 VLDVNGQESIGDIK--NRLRLLADVESEEVTLSMCGAPLEDSCLVSELSSTE 287 +L+++ G I N+L+ L+D +CG PL SC S L+S E Sbjct: 725 ILNLSNNHLSGKIPTGNQLQTLSDPSIYHNNYGLCGFPLNISCTSSSLASDE 776 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,644,362 Number of Sequences: 37544 Number of extensions: 526475 Number of successful extensions: 1052 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5000508548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -