BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C02_e395_06.seq (1556 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 28 0.21 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 27.9 bits (59), Expect = 0.21 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = -3 Query: 312 PTVALQVSVCSSVPPEASTPPSAQ-SLIRHPTSPRIRGYFLHRHLRNRQRPXHVSEAWTS 136 P +A +VSV + PP S PP + + + +S RI F L +R S + S Sbjct: 85 PILAEKVSVSPTTPPTPSPPPEERLTPSKDASSKRIXTAFTSTQLLELER-EFASNMYLS 143 Query: 135 RALQTDLSRTXRRDE 91 R + +++ R E Sbjct: 144 RLRRIEIATCLRLSE 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,091 Number of Sequences: 336 Number of extensions: 1617 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46910650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -