BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C02_e395_06.seq (1556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.76 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 26 1.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.2 bits (55), Expect = 0.76 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 329 GREATXSRXGDHQRRLCNEKXRLXKRIGGDGSR 427 G E R + RRL +E RL K + GD S+ Sbjct: 776 GMETQDYRIPEVMRRLMSEDKRLSKSVNGDQSQ 808 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.8 bits (54), Expect = 1.0 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 300 LQVSVCSSVPPEASTPPSAQ--SLIRHPTSPRIRGYFLHRHLRNRQRP 163 L++ VP PPS S R P +PRI L RH +RP Sbjct: 115 LKIKGLCEVPESRDGPPSVSLSSPPREPGTPRINFTKLKRHHPRYKRP 162 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,470 Number of Sequences: 438 Number of extensions: 2065 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54668625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -