BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_C01_e387_05.seq (1580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC660.15 |||mRNA cleavage factor complex subunit |Schizosaccha... 32 0.19 >SPBC660.15 |||mRNA cleavage factor complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 32.3 bits (70), Expect = 0.19 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 29 SGXPRAAGNSTRQ---VVNELLKTPKQTIGGKEVDVKRATPK 145 +G PR G T + V + P TI GK V+VKRATPK Sbjct: 284 TGRPRGFGFVTYENESAVEATMSQPYITIHGKPVEVKRATPK 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,965,964 Number of Sequences: 5004 Number of extensions: 19027 Number of successful extensions: 44 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 891978300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -