Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_B12_e474_04.seq
         (1443 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_03_0203 - 15417743-15417997,15418708-15419159,15419234-15419636     31   2.2  

>03_03_0203 - 15417743-15417997,15418708-15419159,15419234-15419636
          Length = 369

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +1

Query: 403 VVRVQHFQENIGLEPLFGNARNLVTASAPPDPVTPHA-PRKRASRLNKEPSRKRALKI 573
           V RV+    + G     G  + L++A APP P+TP A     AS   +   +KRAL +
Sbjct: 37  VTRVERRGHHGGHGGALGFIKGLISAFAPPPPLTPSAGAAAAASYYPRVSGKKRALLV 94


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,574,050
Number of Sequences: 37544
Number of extensions: 399182
Number of successful extensions: 907
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 886
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 907
length of database: 14,793,348
effective HSP length: 85
effective length of database: 11,602,108
effective search space used: 4582832660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)