BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_B09_e450_03.seq (1516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 1e-26 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 118 2e-26 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 118 2e-26 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 118 2e-26 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 118 2e-26 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 118 2e-26 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 118 2e-26 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 118 2e-26 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 118 2e-26 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 118 2e-26 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 118 2e-26 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 118 2e-26 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 118 2e-26 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 118 2e-26 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 118 2e-26 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 118 2e-26 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 118 2e-26 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 118 2e-26 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 118 2e-26 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 118 2e-26 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 118 2e-26 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 118 2e-26 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 118 2e-26 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 118 2e-26 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 118 2e-26 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 118 2e-26 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 118 2e-26 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 118 2e-26 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 118 2e-26 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 118 2e-26 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 118 2e-26 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 118 2e-26 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 118 2e-26 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 118 2e-26 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 118 2e-26 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 118 2e-26 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 118 2e-26 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 118 2e-26 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 118 2e-26 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 118 2e-26 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 118 2e-26 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 118 2e-26 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 118 2e-26 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 118 2e-26 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 118 2e-26 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 118 2e-26 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 118 2e-26 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 118 2e-26 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 118 2e-26 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 118 2e-26 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 118 2e-26 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 118 2e-26 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 118 2e-26 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 118 2e-26 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 118 2e-26 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 118 2e-26 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 118 2e-26 SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 118 2e-26 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 118 2e-26 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_931| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 118 2e-26 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_278| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59734| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59691| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59574| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59521| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59292| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_59178| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58804| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58763| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58688| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58626| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58592| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58200| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57995| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57875| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57777| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57569| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57528| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57143| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57123| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57090| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56957| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56844| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56710| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 118 2e-26 SB_56502| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56297| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55990| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55770| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55660| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55432| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55411| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55098| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 118 2e-26 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 118 2e-26 SB_54982| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54744| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54487| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54265| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54261| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_54066| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53976| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 118 bits (284), Expect = 1e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 209 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRTSEEARTDRPSQQLRSLN 268 Query: 526 GE 531 GE Sbjct: 269 GE 270 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 33 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 92 Query: 526 GE 531 GE Sbjct: 93 GE 94 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 526 GE 531 GE Sbjct: 116 GE 117 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 47 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 526 GE 531 GE Sbjct: 107 GE 108 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 526 GE 531 GE Sbjct: 84 GE 85 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 526 GE 531 GE Sbjct: 99 GE 100 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 107 Query: 526 GE 531 GE Sbjct: 108 GE 109 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 526 GE 531 GE Sbjct: 89 GE 90 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 205 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 264 Query: 526 GE 531 GE Sbjct: 265 GE 266 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 100 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 159 Query: 526 GE 531 GE Sbjct: 160 GE 161 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 526 GE 531 GE Sbjct: 96 GE 97 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 370 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 429 Query: 526 GE 531 GE Sbjct: 430 GE 431 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 526 GE 531 GE Sbjct: 88 GE 89 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 27 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 526 GE 531 GE Sbjct: 87 GE 88 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 526 GE 531 GE Sbjct: 94 GE 95 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 329 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 388 Query: 526 GE 531 GE Sbjct: 389 GE 390 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 69 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 128 Query: 526 GE 531 GE Sbjct: 129 GE 130 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 526 GE 531 GE Sbjct: 99 GE 100 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 107 Query: 526 GE 531 GE Sbjct: 108 GE 109 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 123 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 182 Query: 526 GE 531 GE Sbjct: 183 GE 184 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 111 Query: 526 GE 531 GE Sbjct: 112 GE 113 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 526 GE 531 GE Sbjct: 88 GE 89 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 245 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 304 Query: 526 GE 531 GE Sbjct: 305 GE 306 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 526 GE 531 GE Sbjct: 85 GE 86 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 103 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 162 Query: 526 GE 531 GE Sbjct: 163 GE 164 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 385 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 444 Query: 526 GE 531 GE Sbjct: 445 GE 446 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 108 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 167 Query: 526 GE 531 GE Sbjct: 168 GE 169 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 403 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 462 Query: 526 GE 531 GE Sbjct: 463 GE 464 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 526 GE 531 GE Sbjct: 95 GE 96 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 111 Query: 526 GE 531 GE Sbjct: 112 GE 113 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 174 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 233 Query: 526 GE 531 GE Sbjct: 234 GE 235 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 526 GE 531 GE Sbjct: 89 GE 90 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 526 GE 531 GE Sbjct: 103 GE 104 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 40 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 99 Query: 526 GE 531 GE Sbjct: 100 GE 101 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 526 GE 531 GE Sbjct: 84 GE 85 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 526 GE 531 GE Sbjct: 88 GE 89 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 73 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 132 Query: 526 GE 531 GE Sbjct: 133 GE 134 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 329 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 388 Query: 526 GE 531 GE Sbjct: 389 GE 390 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 526 GE 531 GE Sbjct: 135 GE 136 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 526 GE 531 GE Sbjct: 85 GE 86 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 283 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 342 Query: 526 GE 531 GE Sbjct: 343 GE 344 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 46 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 526 GE 531 GE Sbjct: 106 GE 107 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 400 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 459 Query: 526 GE 531 GE Sbjct: 460 GE 461 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 40 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 99 Query: 526 GE 531 GE Sbjct: 100 GE 101 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 82 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 141 Query: 526 GE 531 GE Sbjct: 142 GE 143 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 200 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 259 Query: 526 GE 531 GE Sbjct: 260 GE 261 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 526 GE 531 GE Sbjct: 94 GE 95 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 526 GE 531 GE Sbjct: 84 GE 85 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 184 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 243 Query: 526 GE 531 GE Sbjct: 244 GE 245 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 42 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 526 GE 531 GE Sbjct: 102 GE 103 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 526 GE 531 GE Sbjct: 135 GE 136 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 176 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 235 Query: 526 GE 531 GE Sbjct: 236 GE 237 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 526 GE 531 GE Sbjct: 116 GE 117 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 526 GE 531 GE Sbjct: 99 GE 100 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 65 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 124 Query: 526 GE 531 GE Sbjct: 125 GE 126 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 85 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 144 Query: 526 GE 531 GE Sbjct: 145 GE 146 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 526 GE 531 GE Sbjct: 89 GE 90 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 652 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 711 Query: 526 GE 531 GE Sbjct: 712 GE 713 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 37 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 96 Query: 526 GE 531 GE Sbjct: 97 GE 98 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 26 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 526 GE 531 GE Sbjct: 86 GE 87 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 526 GE 531 GE Sbjct: 85 GE 86 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 69 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 128 Query: 526 GE 531 GE Sbjct: 129 GE 130 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 19 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLN 78 Query: 526 GE 531 GE Sbjct: 79 GE 80 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 526 GE 531 GE Sbjct: 94 GE 95 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 526 GE 531 GE Sbjct: 124 GE 125 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 914 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 973 Query: 526 GE 531 GE Sbjct: 974 GE 975 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 526 GE 531 GE Sbjct: 95 GE 96 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 342 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 401 Query: 526 GE 531 GE Sbjct: 402 GE 403 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 526 GE 531 GE Sbjct: 124 GE 125 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 115 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 174 Query: 526 GE 531 GE Sbjct: 175 GE 176 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 86 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 145 Query: 526 GE 531 GE Sbjct: 146 GE 147 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 526 GE 531 GE Sbjct: 103 GE 104 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 93 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 152 Query: 526 GE 531 GE Sbjct: 153 GE 154 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 526 GE 531 GE Sbjct: 96 GE 97 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 897 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 956 Query: 526 GE 531 GE Sbjct: 957 GE 958 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 526 GE 531 GE Sbjct: 88 GE 89 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 526 GE 531 GE Sbjct: 92 GE 93 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 70 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 129 Query: 526 GE 531 GE Sbjct: 130 GE 131 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 526 GE 531 GE Sbjct: 99 GE 100 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 41 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 100 Query: 526 GE 531 GE Sbjct: 101 GE 102 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 85 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 144 Query: 526 GE 531 GE Sbjct: 145 GE 146 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 526 GE 531 GE Sbjct: 124 GE 125 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 47 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 526 GE 531 GE Sbjct: 107 GE 108 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 60 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 119 Query: 526 GE 531 GE Sbjct: 120 GE 121 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 526 GE 531 GE Sbjct: 96 GE 97 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 42 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 526 GE 531 GE Sbjct: 102 GE 103 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 101 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 160 Query: 526 GE 531 GE Sbjct: 161 GE 162 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 51 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 110 Query: 526 GE 531 GE Sbjct: 111 GE 112 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 62 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 121 Query: 526 GE 531 GE Sbjct: 122 GE 123 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 814 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQMRSLN 873 Query: 526 GE 531 GE Sbjct: 874 GE 875 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 61 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 120 Query: 526 GE 531 GE Sbjct: 121 GE 122 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 46 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 526 GE 531 GE Sbjct: 106 GE 107 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 770 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 829 Query: 526 GE 531 GE Sbjct: 830 GE 831 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 526 GE 531 GE Sbjct: 96 GE 97 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 60 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 119 Query: 526 GE 531 GE Sbjct: 120 GE 121 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 163 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 222 Query: 526 GE 531 GE Sbjct: 223 GE 224 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 31 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 526 GE 531 GE Sbjct: 91 GE 92 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 102 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 161 Query: 526 GE 531 GE Sbjct: 162 GE 163 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 57 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 116 Query: 526 GE 531 GE Sbjct: 117 GE 118 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 82 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 141 Query: 526 GE 531 GE Sbjct: 142 GE 143 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 174 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 233 Query: 526 GE 531 GE Sbjct: 234 GE 235 >SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 526 GE 531 GE Sbjct: 85 GE 86 >SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 526 GE 531 GE Sbjct: 135 GE 136 >SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 526 GE 531 GE Sbjct: 88 GE 89 >SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 545 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 604 Query: 526 GE 531 GE Sbjct: 605 GE 606 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 44 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 526 GE 531 GE Sbjct: 104 GE 105 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 526 GE 531 GE Sbjct: 103 GE 104 >SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 55 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 114 Query: 526 GE 531 GE Sbjct: 115 GE 116 >SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 450 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 509 Query: 526 GE 531 GE Sbjct: 510 GE 511 >SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 872 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 931 Query: 526 GE 531 GE Sbjct: 932 GE 933 >SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 225 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 284 Query: 526 GE 531 GE Sbjct: 285 GE 286 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 68 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 127 Query: 526 GE 531 GE Sbjct: 128 GE 129 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 526 GE 531 GE Sbjct: 95 GE 96 >SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 526 GE 531 GE Sbjct: 83 GE 84 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 526 GE 531 GE Sbjct: 84 GE 85 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 81 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 140 Query: 526 GE 531 GE Sbjct: 141 GE 142 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 1043 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 1102 Query: 526 GE 531 GE Sbjct: 1103 GE 1104 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 54 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 526 GE 531 GE Sbjct: 114 GE 115 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 526 GE 531 GE Sbjct: 99 GE 100 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 142 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 201 Query: 526 GE 531 GE Sbjct: 202 GE 203 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 614 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 673 Query: 526 GE 531 GE Sbjct: 674 GE 675 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 74 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 133 Query: 526 GE 531 GE Sbjct: 134 GE 135 Score = 98.3 bits (234), Expect = 1e-20 Identities = 44/52 (84%), Positives = 44/52 (84%) Frame = -3 Query: 530 SPXRXRXCWEGRSVRAXXXXRQLXKGGCAARRLSWVTPGFSQSRRCKTTASE 375 SP R R CWEGRSVRA RQL KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 5 SPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 56 >SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 238 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 297 Query: 526 GE 531 GE Sbjct: 298 GE 299 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 33 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 92 Query: 526 GE 531 GE Sbjct: 93 GE 94 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 526 GE 531 GE Sbjct: 89 GE 90 >SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 344 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 403 Query: 526 GE 531 GE Sbjct: 404 GE 405 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 86 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 145 Query: 526 GE 531 GE Sbjct: 146 GE 147 >SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 84 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 143 Query: 526 GE 531 GE Sbjct: 144 GE 145 >SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 44 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 526 GE 531 GE Sbjct: 104 GE 105 >SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 30 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 526 GE 531 GE Sbjct: 90 GE 91 >SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 26 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 526 GE 531 GE Sbjct: 86 GE 87 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 213 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 272 Query: 526 GE 531 GE Sbjct: 273 GE 274 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 526 GE 531 GE Sbjct: 124 GE 125 >SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 526 GE 531 GE Sbjct: 105 GE 106 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 231 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 290 Query: 526 GE 531 GE Sbjct: 291 GE 292 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 51 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 110 Query: 526 GE 531 GE Sbjct: 111 GE 112 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 526 GE 531 GE Sbjct: 103 GE 104 >SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 526 GE 531 GE Sbjct: 78 GE 79 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 60 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 119 Query: 526 GE 531 GE Sbjct: 120 GE 121 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 37 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 96 Query: 526 GE 531 GE Sbjct: 97 GE 98 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 526 GE 531 GE Sbjct: 98 GE 99 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 81 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 140 Query: 526 GE 531 GE Sbjct: 141 GE 142 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 27 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 526 GE 531 GE Sbjct: 87 GE 88 >SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 62 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 121 Query: 526 GE 531 GE Sbjct: 122 GE 123 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 105 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 164 Query: 526 GE 531 GE Sbjct: 165 GE 166 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 124 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 183 Query: 526 GE 531 GE Sbjct: 184 GE 185 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 41 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 100 Query: 526 GE 531 GE Sbjct: 101 GE 102 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 118 bits (283), Expect = 2e-26 Identities = 53/62 (85%), Positives = 53/62 (85%) Frame = +1 Query: 346 NSPYXESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFXSWRXXXXARTDRPSQQXRXLX 525 NSPY ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF SWR ARTDRPSQQ R L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 526 GE 531 GE Sbjct: 94 GE 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,593,035 Number of Sequences: 59808 Number of extensions: 447318 Number of successful extensions: 4975 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4973 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -