BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_B06_e426_04.seq (1530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59530| Best HMM Match : NAC (HMM E-Value=4.6e-05) 59 1e-08 SB_26449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.80 >SB_59530| Best HMM Match : NAC (HMM E-Value=4.6e-05) Length = 98 Score = 58.8 bits (136), Expect = 1e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 372 VNTIPGIEEVNMIKDDGTVIHFNNPKAQASLAA 470 VN IPGIEEVNMIK+DGTVIHFNNPKA+ A Sbjct: 54 VNPIPGIEEVNMIKEDGTVIHFNNPKAEMGSGA 86 >SB_26449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 32.7 bits (71), Expect = 0.80 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +3 Query: 609 DEDDEVPNLVGNFDEAS 659 DEDDEVP LV NFDE S Sbjct: 10 DEDDEVPELVENFDEPS 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,394,263 Number of Sequences: 59808 Number of extensions: 570509 Number of successful extensions: 917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4976817448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -