BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_B03_e402_03.seq (1331 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.8 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.8 >SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.39 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 60 PAARGIH*XLERPPPR 13 PAARGIH LERPPPR Sbjct: 14 PAARGIHYVLERPPPR 29 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 91 PSEASPSCRIXCSPGDPLV 35 P EAS S CSPGDPLV Sbjct: 46 PHEASRSASNSCSPGDPLV 64 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 Query: 114 RNSKRCENQAKLLPRAEXPAARGIH*XLERPPPR 13 +N +RC +LPR + G LERPPPR Sbjct: 44 KNYQRCTPVVGMLPRRSNSCSPGDPLVLERPPPR 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,062,069 Number of Sequences: 59808 Number of extensions: 129197 Number of successful extensions: 1168 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1160 length of database: 16,821,457 effective HSP length: 84 effective length of database: 11,797,585 effective search space used: 4235333015 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -