Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_B01_e386_03.seq
         (1520 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, p...    32   1.1  

>At1g43190.1 68414.m04977 polypyrimidine tract-binding protein,
           putative / heterogeneous nuclear ribonucleoprotein,
           putative similar to Polypyrimidine tract-binding protein
           1 (PTB) (Heterogeneous nuclear ribonucleoprotein I)
           (hnRNP I) from {Rattus norvegicus} SP|Q00438, {Homo
           sapiens} SP|P26599, [Homo sapiens] GI:35770; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 432

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = -1

Query: 380 HPHFAELSSVSDVTGGGVPVTISGTNSRLRDDTEQKNPISLD 255
           +P  A  S+++   GGG+P  I+GTN R        N  S+D
Sbjct: 217 YPQMANTSAIAAAFGGGLPPGITGTNDRCTVLVSNLNADSID 258


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,592,965
Number of Sequences: 28952
Number of extensions: 419656
Number of successful extensions: 899
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 877
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 899
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4067485824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)