BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A11_e465_01.seq (1548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 42 0.001 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.022 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.022 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 35 0.15 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 35 0.20 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 34 0.27 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.35 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.35 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.35 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.61 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 33 0.81 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.81 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.81 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.1 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.1 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 1.1 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 32 1.1 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 32 1.4 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 1.4 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 31 2.5 SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) 31 2.5 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 2.5 SB_54954| Best HMM Match : zf-RanBP (HMM E-Value=2.1) 31 3.3 SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.3 SB_44302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.3 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.3 SB_42153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 4.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.3 SB_17493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.3 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 4.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 4.3 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.3 SB_27478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.7 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 30 5.7 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 29 7.6 SB_42474| Best HMM Match : Collagen (HMM E-Value=0.14) 29 7.6 SB_12790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 29 7.6 SB_50275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 29 7.6 SB_58049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 10.0 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 10.0 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 41.9 bits (94), Expect = 0.001 Identities = 37/133 (27%), Positives = 40/133 (30%), Gaps = 4/133 (3%) Frame = +1 Query: 1156 GPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGG 1335 GP P PGPP +G GP P +G P +G Sbjct: 626 GPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGNPAGVQGP 685 Query: 1336 RXXAGPP----PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXG 1503 GPP P GE G G P P PP P P G P G P G Sbjct: 686 NGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPG--PNGPP--GPNGPLG 741 Query: 1504 XPGXXXPGPPXXG 1542 PG P G Sbjct: 742 PPGECGPAGNAGG 754 Score = 41.1 bits (92), Expect = 0.002 Identities = 36/131 (27%), Positives = 39/131 (29%), Gaps = 2/131 (1%) Frame = +1 Query: 1156 GPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGG 1335 GP P PGPP G GP P G P +G Sbjct: 711 GPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGNAGGVGCQGHHGNPAGSQGP 770 Query: 1336 RXXAGPPPXXX-FGEXGXRGAPPXTXPXGGXPRGAPPXPXXXT-PXGXPXGGXXPPXGXP 1509 GPP G+ G G P P G +PP P P G P G P G P Sbjct: 771 NGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP--GPNGPLGPP 828 Query: 1510 GXXXPGPPXXG 1542 G P G Sbjct: 829 GECGPAGNAGG 839 Score = 39.5 bits (88), Expect = 0.007 Identities = 34/119 (28%), Positives = 36/119 (30%), Gaps = 5/119 (4%) Frame = +1 Query: 1156 GPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGG 1335 GP P PGPP +G GP P G P +G Sbjct: 796 GPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGP 855 Query: 1336 RXXAGPP----PXXXFGEXGXRGAPPXTXPXG-GXPRGAPPXPXXXTPXGXPXGGXXPP 1497 GPP P GE G G P P P G P P P G P G PP Sbjct: 856 NGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPG-PNGCLGPP 913 Score = 38.7 bits (86), Expect = 0.012 Identities = 38/126 (30%), Positives = 42/126 (33%), Gaps = 7/126 (5%) Frame = +1 Query: 1177 PKXXPGPPXXARXRG-GGGPXFXXPV--PXGAGFRAQXXXANPXSRXXXPRRXRGGRXXA 1347 P+ PGPP G G P P+ P AG P +G Sbjct: 460 PQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQP 519 Query: 1348 GPP----PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGX 1515 GPP P G+ G G P P P G P P P G P G P G PG Sbjct: 520 GPPGINGPPGPLGDVGPPGLPGPPGPQ--MPPGPPGLPGAPGPNGPP--GINGPLGPPGE 575 Query: 1516 XXPGPP 1533 GPP Sbjct: 576 A--GPP 579 Score = 37.9 bits (84), Expect = 0.022 Identities = 37/129 (28%), Positives = 40/129 (31%), Gaps = 7/129 (5%) Frame = +1 Query: 1177 PKXXPGPPXXARXRGGGGP-XFXXPV--PXGAGFRAQXXXANPXSRXXXPRRXRGGRXXA 1347 P+ PGPP G GP P+ P AG P +G Sbjct: 545 PQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQP 604 Query: 1348 GPP----PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGX 1515 GPP P GE G G P P PP P P G P G P G PG Sbjct: 605 GPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPG--PKGPP--GPNGPLGPPGE 660 Query: 1516 XXPGPPXXG 1542 P G Sbjct: 661 SGPAGNAGG 669 Score = 34.7 bits (76), Expect = 0.20 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = +1 Query: 1345 AGPPPXXXFGEXGXRGAPPXTXPXG--GXP--RGAPPXPXXXTPXGXPXGGXXPPXGXPG 1512 A PPP G G G P P G G P G P P P G P G PP G PG Sbjct: 37 APPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPP-GLPG 95 Query: 1513 -XXXPGPP 1533 GPP Sbjct: 96 PNGVNGPP 103 Score = 33.9 bits (74), Expect = 0.35 Identities = 45/155 (29%), Positives = 47/155 (30%), Gaps = 14/155 (9%) Frame = +1 Query: 1111 PPSYREFPDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGF-RAQXXX 1287 PP ++ P P GP P GPP G GP P P G Sbjct: 74 PPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGP----PGPPGPQMPPGPPGL 129 Query: 1288 ANPXSRXXXP--RRXRGGRXXAGPPPX-XXFGEXGXRGAP-----PXTXPXGGXPRGAPP 1443 P P G GPP G G G P P P P G P Sbjct: 130 PGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPG 189 Query: 1444 XPXXXTPXG--XPXGGXXPPX--GXPGXXXP-GPP 1533 P P G P G PP G PG P GPP Sbjct: 190 PPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 31.1 bits (67), Expect = 2.5 Identities = 47/155 (30%), Positives = 47/155 (30%), Gaps = 14/155 (9%) Frame = +1 Query: 1111 PPSYREFPDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXA 1290 PP PD P GP PK PG P G P F P AG Sbjct: 40 PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP-----GPPGFQGPPGNPAGAIGPPGLP 94 Query: 1291 NPXSRXXXPRR--XRGGRXXAGPP-PXXXFGEXGXRG-----APPXTX-----PXGGXPR 1431 P P G GPP P G G G PP T P P Sbjct: 95 GPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPP 154 Query: 1432 GAPPXPXXXTPXGXPXGGXXPPXGXPGXXXP-GPP 1533 G P P G P G P G PG P GPP Sbjct: 155 GNPGGPGLQGNHGNP-AGIQGPNGLPGPNGPLGPP 188 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 37.9 bits (84), Expect = 0.022 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 1399 PXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPG 1527 P G P GAPP P P G P G PP G P PG Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPG 270 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 1396 PPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPG--PP 1533 PP + P G P P P G P G PP G P PG PP Sbjct: 243 PPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPP 290 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 37.9 bits (84), Expect = 0.022 Identities = 39/126 (30%), Positives = 44/126 (34%), Gaps = 9/126 (7%) Frame = +1 Query: 1192 GPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPPPXXXF 1371 GPP +GGG P P G G+ A P +GG GPPP Sbjct: 502 GPPPPGAGQGGGPP----PPGAGQGWGQPPPGAGQGGGPPPPGAGQGG----GPPPPGA- 552 Query: 1372 GEXGXRGAPPXTXPXGGXP-----RGAPPXPXXXT----PXGXPXGGXXPPXGXPGXXXP 1524 G+ G PP GG P +G PP P P G GG PP G Sbjct: 553 GQ-GWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGL 611 Query: 1525 GPPXXG 1542 PP G Sbjct: 612 PPPGSG 617 Score = 35.1 bits (77), Expect = 0.15 Identities = 23/71 (32%), Positives = 25/71 (35%) Frame = +1 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP 1509 GG+ PPP G+ G PP GG P P G GG PP G Sbjct: 486 GGQGWGQPPPGA--GQGGGP-PPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 542 Query: 1510 GXXXPGPPXXG 1542 P PP G Sbjct: 543 QGGGPPPPGAG 553 Score = 34.7 bits (76), Expect = 0.20 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 1529 GPGXXXPGXPXGGXXPPXGXPXGVXXXGXG-GAPRGXPPXGXVXGGAPLXPXSPNXXXGG 1353 G G PG GG PP G G G G G PP G GG P P GG Sbjct: 489 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG---PPPPGAGQGG 545 Query: 1352 GP 1347 GP Sbjct: 546 GP 547 Score = 34.3 bits (75), Expect = 0.27 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 8/73 (10%) Frame = -2 Query: 1541 PXXG-GPGXXXPGXPXGGXXPPXGXPXGVXXXGXG-GAPRGXPPXGXVXGGAP------L 1386 P G G G PG GG PP G G G G G PP G GG P Sbjct: 528 PGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQE 587 Query: 1385 XPXSPNXXXGGGP 1347 P P GGGP Sbjct: 588 GPPPPGAGQGGGP 600 Score = 33.9 bits (74), Expect = 0.35 Identities = 27/75 (36%), Positives = 28/75 (37%), Gaps = 10/75 (13%) Frame = -2 Query: 1541 PXXG-GPGXXXPGXPXGGXXPPXGXPXGVXXXGXG-GAPRGXPPXGXVXGGAPLXPXS-- 1374 P G G G PG GG PP G G G G G PP G GG P P + Sbjct: 495 PGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQ 554 Query: 1373 ------PNXXXGGGP 1347 P GGGP Sbjct: 555 GWGQPPPGAGQGGGP 569 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 1541 PXXG-GPGXXXPGXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXP 1380 P G G G PG GG PP G G G G PP G GG P P Sbjct: 550 PGAGQGWGQPPPGAGQGGGPPPPGAGQG-GPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 29.9 bits (64), Expect = 5.7 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +1 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP 1509 G GPPP G+ G P G P GA P GG PP Sbjct: 496 GAGQGGGPPPPGA-GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQ 554 Query: 1510 GXXXPGPPXXG 1542 G P PP G Sbjct: 555 GWGQP-PPGAG 564 Score = 29.1 bits (62), Expect = 10.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 1440 GGPPGXAXPGXGXGGXAPXAXFPEXXXGRGPGXGXAPP 1327 GGPP PG G GG P E G G G PP Sbjct: 567 GGPPP---PGAGQGGPPPPGAGQEGPPPPGAGQGGGPP 601 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 35.1 bits (77), Expect = 0.15 Identities = 38/147 (25%), Positives = 44/147 (29%), Gaps = 7/147 (4%) Frame = +1 Query: 1114 PSYREFPDRPCLGXGPXQXXLPKXXPG--PPX--XARXRGGGGPXFXXPVPXGAGFRAQX 1281 P ++ P G P P PG PP +GG P P P + Q Sbjct: 102 PPLQQRQQHPPPGHPPMGGGYPGQQPGGPPPSYDSTMQQGGSYPPGQQPYPGQQAYPGQP 161 Query: 1282 XXA---NPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPX 1452 + P P+ G PP G P G P G PP Sbjct: 162 GASPQGQPYPGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMW--GPPPMGGPP--- 216 Query: 1453 XXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 P G P GG PP PG P P Sbjct: 217 ---PMGGPPGGYPPPPPPPGAGDPAYP 240 Score = 30.3 bits (65), Expect = 4.3 Identities = 33/123 (26%), Positives = 40/123 (32%), Gaps = 7/123 (5%) Frame = +1 Query: 1195 PPXXARXRGGGGPXFX--XPVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPPPXXX 1368 PP GGG P P P Q P + ++ G+ A P Sbjct: 111 PPPGHPPMGGGYPGQQPGGPPPSYDSTMQQGGSYPPGQQPYPGQQAYPGQPGASPQGQPY 170 Query: 1369 FGEXGXRGAPPXTXPXGGXPRG----APPXPXXXTPXGXPXGGXXPPXGXP-GXXXPGPP 1533 G+ +G P G P G + P P G P G PP G P G P PP Sbjct: 171 PGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPP 230 Query: 1534 XXG 1542 G Sbjct: 231 PPG 233 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.7 bits (76), Expect = 0.20 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 1541 PXXGGPGXXXPGXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSP 1371 P GG P P G PP P G GGAP PP G G AP P P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPG---GSAPPPPPPP 988 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP G PP P G P PP P P GG PP G P P Sbjct: 920 PPPPPPPGGNAPLPPPP---PGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Query: 1531 P 1533 P Sbjct: 977 P 977 Score = 33.5 bits (73), Expect = 0.46 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +1 Query: 1315 PRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXP 1494 PRR G G PP P G P PP P GG P Sbjct: 894 PRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAP 953 Query: 1495 PXGXPGXXXPGPPXXG 1542 P P PP G Sbjct: 954 PPPPPPGGSAPPPGGG 969 Score = 33.1 bits (72), Expect = 0.61 Identities = 27/100 (27%), Positives = 28/100 (28%) Frame = +1 Query: 1150 GXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXR 1329 G P + P PG GG P P G A P Sbjct: 891 GSFPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGN--APLPPPPPGGSAPSQPPPP 948 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXP 1449 GG PPP GAPP P GG PP P Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 32.7 bits (71), Expect = 0.81 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +1 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP 1509 GG PPP AP P GG PP P P P GG P P Sbjct: 927 GGNAPLPPPPPGG-------SAPSQPPPPGGNAPPPPPPPGGSAP--PPGGGAPPLPPPP 977 Query: 1510 GXXXPGPP 1533 G P PP Sbjct: 978 GGSAPPPP 985 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 1328 GGAXPXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGGPP 1441 GG P P P P + GA P P PG + P PP Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Score = 31.5 bits (68), Expect = 1.9 Identities = 25/79 (31%), Positives = 26/79 (32%) Frame = +1 Query: 1294 PXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGX 1473 P P GG + PPP APP P GG APP P Sbjct: 926 PGGNAPLPPPPPGGSAPSQPPPPGG-------NAPPPPPPPGGS---APPPGGGAPPLPP 975 Query: 1474 PXGGXXPPXGXPGXXXPGP 1530 P GG PP P P P Sbjct: 976 PPGGSAPPPPPPPPPPPPP 994 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.7 bits (76), Expect = 0.20 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 1396 PPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPPXXG 1542 PP P GG GAPP P P P G PP G P PP G Sbjct: 662 PPPPPPPGGQAGGAPPPP----PPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.9 bits (64), Expect = 5.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 1346 PGPRPXXXSGNXAXGAXPPXP--XPGXAXPGGPP 1441 P P P G A GA PP P PG A P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 29.5 bits (63), Expect = 7.6 Identities = 23/54 (42%), Positives = 24/54 (44%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPG 1512 PPP G+ G GAPP P P GA P P P P GG PP PG Sbjct: 663 PPPPPPGGQAG--GAPPPPPP--PLPGGAAPPP---PP---PIGGGAPPPPPPG 706 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 1348 GPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPG 1527 GPP +G PP P G PP P P G P P G PG PG Sbjct: 346 GPPGNMSMPNHRPQGLPPGMPPMALSLPGMPP-PGLLPPPGMPPRLPIPGLGLPGMPLPG 404 Query: 1528 PP 1533 P Sbjct: 405 MP 406 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 33.9 bits (74), Expect = 0.35 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = +1 Query: 1345 AGPP-PXXXFGEXGXRGAPPXTXPXG--GXPRGAPPXPXXXTPXGXPXGGXXPPX-GXPG 1512 AGPP P GE G GAP P G G P G P G P P G PG Sbjct: 102 AGPPGPPGHVGEDGAPGAPGAPGPPGSPGAP-GLPGEKGDPGLQGAPGAAGLPGAPGLPG 160 Query: 1513 XXXP-GPP 1533 P GPP Sbjct: 161 PQGPMGPP 168 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 33.9 bits (74), Expect = 0.35 Identities = 41/145 (28%), Positives = 41/145 (28%) Frame = +1 Query: 1108 FPPSYREFPDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXX 1287 FPP P P G P P P P R G P P P R Sbjct: 441 FPPPGAPHPRVPPPGA-PHPRVPPPGAPHP----RVPPPGAPHPRVPPPGAPHPRVPPPG 495 Query: 1288 ANPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPX 1467 A P R P G PPP GAP P G P P P P Sbjct: 496 A-PHQRVPPP----GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPR 550 Query: 1468 GXPXGGXXPPXGXPGXXXPGPPXXG 1542 P G P PG P P G Sbjct: 551 VPPPGASHPRVPPPGAPHPRVPPPG 575 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP GAP P G P P P P P G P PG P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRV 581 Query: 1531 PXXG 1542 P G Sbjct: 582 PPPG 585 Score = 31.5 bits (68), Expect = 1.9 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP GAP P G P P P P P G P PG P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 471 Query: 1531 PXXG 1542 P G Sbjct: 472 PPPG 475 Score = 31.5 bits (68), Expect = 1.9 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP GAP P G P P P P P G P PG P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 491 Query: 1531 PXXG 1542 P G Sbjct: 492 PPPG 495 Score = 31.5 bits (68), Expect = 1.9 Identities = 40/144 (27%), Positives = 40/144 (27%) Frame = +1 Query: 1111 PPSYREFPDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXA 1290 PP P P G P Q P P P R G P P P R A Sbjct: 482 PPPGAPHPRVPPPGA-PHQRVPPPGAPHP----RVPPPGAPHPRVPPPGAPHPRVPPPGA 536 Query: 1291 NPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXG 1470 P R P G PPP GAP P G P P P P Sbjct: 537 -PHPRVPPP----GAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV 591 Query: 1471 XPXGGXXPPXGXPGXXXPGPPXXG 1542 P G P PG P G Sbjct: 592 PPPGAPHPKVPPPGAPYQRLPYSG 615 Score = 29.9 bits (64), Expect = 5.7 Identities = 37/129 (28%), Positives = 38/129 (29%) Frame = +1 Query: 1156 GPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGG 1335 GP LP PG P AR G P P + R A P R P G Sbjct: 366 GPYTRALP---PGEPY-ARMPPPGATHPRVPSPGASHPRVPPPGA-PHPRVPPP----GA 416 Query: 1336 RXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGX 1515 PP GAP P G P P P P P G P PG Sbjct: 417 SHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA 476 Query: 1516 XXPGPPXXG 1542 P P G Sbjct: 477 PHPRVPPPG 485 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.9 bits (74), Expect = 0.35 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +1 Query: 1345 AGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPP-XPXXXTPX-GXPXGGXXPPXGXPGXX 1518 A PPP G PP P G P PP P P P PP G Sbjct: 137 APPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPP 196 Query: 1519 XPGPP 1533 P PP Sbjct: 197 PPPPP 201 Score = 29.9 bits (64), Expect = 5.7 Identities = 22/80 (27%), Positives = 24/80 (30%) Frame = +1 Query: 1291 NPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXG 1470 +P +R P PPP G PP P P AP P Sbjct: 132 SPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVP--APAVPLAAASPP 189 Query: 1471 XPXGGXXPPXGXPGXXXPGP 1530 P GG PP P P P Sbjct: 190 PPSGGPPPPPPPPPPPPPPP 209 Score = 29.5 bits (63), Expect = 7.6 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP E + P P R PP P G P PP P P P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGP---PPPPPIAPATGGPPP 166 Query: 1531 P 1533 P Sbjct: 167 P 167 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 33.5 bits (73), Expect = 0.46 Identities = 23/72 (31%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = +1 Query: 1333 GRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP- 1509 G+ G + + AP GG PRG PP G P G PP P Sbjct: 44 GKEIFGRALNIEYAQEKESSAPRRGGYGGGPPRG-PPRGHPMRGRGAPYGRGGPPSRGPP 102 Query: 1510 -GXXXPGPPXXG 1542 G PGPP G Sbjct: 103 RGPPLPGPPRRG 114 Score = 29.9 bits (64), Expect = 5.7 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 4/78 (5%) Frame = -2 Query: 1541 PXXGGPGXXXP-GXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLX---PXS 1374 P GG G P G P G G P G GG P PP G G P P Sbjct: 65 PRRGGYGGGPPRGPPRGHPMRGRGAPYG-----RGGPPSRGPPRGPPLPGPPRRGPPPDR 119 Query: 1373 PNXXXGGGPAXXRPPRXR 1320 + G G RPP R Sbjct: 120 DSGYGGYGDRYDRPPPDR 137 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.61 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 1396 PPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 PP P AP P P G P PP G P P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 32.7 bits (71), Expect = 0.81 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 1382 AXGAXPPXPXPGXAXPGGPPLXXXXXPXGXXRXGXXP 1492 A GA PP G A PGGPPL P G G P Sbjct: 803 ARGAPPPG---GRAAPGGPPLRGGMAPRGAVPRGMAP 836 Score = 31.1 bits (67), Expect = 2.5 Identities = 38/136 (27%), Positives = 40/136 (29%), Gaps = 12/136 (8%) Frame = +1 Query: 1132 PDRPCLGXGPXQXXLPKXXPGPPXXARXRG------GGGPXFXXPVPXGAGFR-AQXXXA 1290 P + G P PK P P A +G G P P GA R A A Sbjct: 694 PQQQAYGAPPASVAAPKAYPPPAAAAAPQGYPPSSAPTGYQARGPAPPGAKPRVAAPYGA 753 Query: 1291 NP---XSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXP--RGAPPXPXX 1455 P P GR G P G G G P RGAPP Sbjct: 754 VPRPGAPAATAPPGAPVGRGILGAIPGQR-GPAPVHGGLAGRGAMRGVPVARGAPPPGGR 812 Query: 1456 XTPXGXPXGGXXPPXG 1503 P G P G P G Sbjct: 813 AAPGGPPLRGGMAPRG 828 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGA---PPXPXXXTPXGXPXGGXXPPXGXPGXXX 1521 PP G APP P P GA P P P G P G PG Sbjct: 725 PPSSAPTGYQARGPAPPGAKPRVAAPYGAVPRPGAPAATAPPGAPVGRGI-LGAIPGQRG 783 Query: 1522 PGPPXXG 1542 P P G Sbjct: 784 PAPVHGG 790 Score = 30.3 bits (65), Expect = 4.3 Identities = 33/108 (30%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +1 Query: 1195 PPXXARXRG--GGGPXFXXPVPXGAGFRAQXXXAN-PXSRXXXPRRXRGGRXXAGPPPXX 1365 PP RG G P P P G + P +R P GGR G PP Sbjct: 765 PPGAPVGRGILGAIPGQRGPAPVHGGLAGRGAMRGVPVARGAPPP---GGRAAPGGPPLR 821 Query: 1366 XFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP 1509 G RGA P G PRG P P G P G P Sbjct: 822 --GGMAPRGA----VPRGMAPRGNPRLP-MNPQAGIPRSQFRGARGSP 862 Score = 29.9 bits (64), Expect = 5.7 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = -2 Query: 1508 GXPXGGXXPPXG---XPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSP 1371 G P PP G P G G G APRG P G G P P +P Sbjct: 799 GVPVARGAPPPGGRAAPGGPPLRG-GMAPRGAVPRGMAPRGNPRLPMNP 846 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 32.7 bits (71), Expect = 0.81 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = +2 Query: 1331 GAXPXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGGPPLXXXXXPXGXXRXGXXPPPXXSX 1510 G P GP SG GA P P P A P GPP P G G PPP + Sbjct: 2149 GPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP------PMGAPPSG--PPPMGTP 2200 Query: 1511 XXG 1519 G Sbjct: 2201 PSG 2203 Score = 30.3 bits (65), Expect = 4.3 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -2 Query: 1541 PXXGGPGXXXPGXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXX 1362 P P P P PP G P + G P G PP G GAP P P Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPP-MGAPPSGPPPMGTPPSGHPPMGAP--PMGPPPS 2217 Query: 1361 XGGGPA 1344 PA Sbjct: 2218 GSHSPA 2223 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 32.7 bits (71), Expect = 0.81 Identities = 20/67 (29%), Positives = 22/67 (32%) Frame = +2 Query: 1331 GAXPXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGGPPLXXXXXPXGXXRXGXXPPPXXSX 1510 G P P P + G P P P PGG P P G G PPP + Sbjct: 590 GTYPPPHPSGGYPQPSPPHGGHPHHPPP-TGYPGGYPGTHTAPPAGGYPTGQHPPPPPAG 648 Query: 1511 XXGAXAP 1531 G P Sbjct: 649 YPGYGPP 655 Score = 30.7 bits (66), Expect = 3.3 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = +1 Query: 1291 NPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXG 1470 +P P GG PP G G AP P GG P G P P P G Sbjct: 596 HPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAP----PAGGYPTGQHPPP---PPAG 648 Query: 1471 XPXGGXXPPXG 1503 P G PP G Sbjct: 649 YP-GYGPPPAG 658 Score = 29.1 bits (62), Expect = 10.0 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 5/69 (7%) Frame = +1 Query: 1351 PPPXXXFG---EXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPP--XGXPGX 1515 PPP G G P P G P G P G P G PP G PG Sbjct: 593 PPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAGYPGY 652 Query: 1516 XXPGPPXXG 1542 GPP G Sbjct: 653 ---GPPPAG 658 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 32.3 bits (70), Expect = 1.1 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +1 Query: 1348 GPP-PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPG-XXX 1521 GPP P G G +G T P G PP P TP G P G PG Sbjct: 843 GPPGPPGPPGVTGEQGVKGDTGPSGEPGPAGPPGP-LGTPGTQGAKGEPGPLGTPGRQGL 901 Query: 1522 PGPP 1533 GPP Sbjct: 902 AGPP 905 Score = 29.5 bits (63), Expect = 7.6 Identities = 36/125 (28%), Positives = 40/125 (32%), Gaps = 11/125 (8%) Frame = +1 Query: 1192 GPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPPPXXXF 1371 GPP RG GP P G + A P + P + P P Sbjct: 513 GPPGPDGDRGPQGPT-GFP-----GTKGNQGIAGPPGQIGDPGKMGPQGFKGDPGPPGPP 566 Query: 1372 GEXGXRGAPPXTXPXG--------GXP--RGAPPXPXXXTPXGXPXGGXXPPXGXPG-XX 1518 GE G GAP P G G P +GA TP G P G G Sbjct: 567 GEVGVPGAPGMKGPIGKPGPVGDAGAPGEKGARGLSIQGTPGMDGKRGPRGPIGEKGPTG 626 Query: 1519 XPGPP 1533 PGPP Sbjct: 627 FPGPP 631 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 32.3 bits (70), Expect = 1.1 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 5/74 (6%) Frame = +1 Query: 1327 RGGRXXAGPPPXXXF-GEXGXRG--APPXTXPXGG--XPRGAPPXPXXXTPXGXPXGGXX 1491 RG + AG F GE G G PP G P G P P G P Sbjct: 869 RGKKGEAGSDGRPGFPGESGANGLPGPPGLAGSPGPRGPNGEPGDPGMDGDKGPPGPVDA 928 Query: 1492 PPXGXPGXXXPGPP 1533 P G PG PGPP Sbjct: 929 GPRGPPG--EPGPP 940 Score = 31.1 bits (67), Expect = 2.5 Identities = 40/143 (27%), Positives = 43/143 (30%), Gaps = 16/143 (11%) Frame = +1 Query: 1132 PDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGF---RAQXXXANPXS 1302 P P GP P+ PG P G GP P GF R P Sbjct: 22 PPGPEGNMGPRGQPGPEGSPGLPGERGTGGVPGPKGKQGAPGTIGFPGSRGDTGDLGPPG 81 Query: 1303 RXXXPRRXR----GGRXXAGPPPX-------XXFGEXGXRGAPPXTXPXGGXPRGAPPXP 1449 P + G AGPP G G G T P G P+G P P Sbjct: 82 AKGLPGAQQYGLPGPLGEAGPPGSQGSPGAPGIIGMNGAMGKKGDTGPLG--PKGQPGSP 139 Query: 1450 XXXTPXGXPXGGXXPP--XGXPG 1512 P P G PP G PG Sbjct: 140 GIDIP--GPKGMDGPPGEKGLPG 160 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 32.3 bits (70), Expect = 1.1 Identities = 42/144 (29%), Positives = 43/144 (29%) Frame = +1 Query: 1111 PPSYREFPDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXA 1290 PPS P P G P P PP R G P P P + R Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPA----RMGTAPP--PPPPSRSSQRPP---- 339 Query: 1291 NPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXG 1470 P SR P G PPP G PP P GG P PP P P Sbjct: 340 -PPSRGAPPPPSMG----MAPPPVG-----GAAPPPPPPPPVGGPP--PPPPPIEGRPPS 387 Query: 1471 XPXGGXXPPXGXPGXXXPGPPXXG 1542 PP G PGP G Sbjct: 388 SLGNPPPPPPPGRGAPPPGPMIPG 411 Score = 29.5 bits (63), Expect = 7.6 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +2 Query: 1331 GAXPXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGGPP-LXXXXXPXGXXRXGXXPPP 1498 G P P P + GA PP P G A P P + P R PPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 32.3 bits (70), Expect = 1.1 Identities = 26/72 (36%), Positives = 28/72 (38%), Gaps = 5/72 (6%) Frame = +1 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXP--XGGXXPP-- 1497 G + GPP G G +G P P G P G P P P G P G PP Sbjct: 51 GPQGTKGPPGSQ--GLSGVQGYPGAPGPRGRSPPGPPGIPG---PRGLPGYRGPKGPPGY 105 Query: 1498 XGXPG-XXXPGP 1530 G PG PGP Sbjct: 106 QGMPGIAGAPGP 117 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -2 Query: 1532 GGPGXXXPGXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXXXGG 1353 G PG PG P G P G+ G P G P G P SP G Sbjct: 1375 GSPGSGIPGSPGSGI--PGSPGSGIPGSPGSGIP-GSPGSGIPGSPGSGIPGSPGSGIPG 1431 Query: 1352 GPA 1344 PA Sbjct: 1432 NPA 1434 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 31.9 bits (69), Expect = 1.4 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 1328 GGAXPXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGGPPLXXXXXPXGXXRXGXXPPP 1498 GG P P P P S A PP P PG A P PP P G PPP Sbjct: 286 GGGAPVPPPPPADGS----APAPPPPPPPGGAPPPPPP-----PPPPPPGDGGAPPP 333 Score = 29.5 bits (63), Expect = 7.6 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +1 Query: 1330 GGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXP 1509 GG PPP G APP P P GAPP P P GG PP P Sbjct: 286 GGGAPVPPPPPAD----GSAPAPPPPPP----PGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 31.5 bits (68), Expect = 1.9 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 1354 PPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPP-XGXPGXXXPGP 1530 PP G + PP G P G PP P P G PP G P GP Sbjct: 200 PPDMMHGRGMGKRFPPGRPGGPGMPPGGPP---PFPPTSDPNMGHHPPISGPPTTSMSGP 256 Query: 1531 P 1533 P Sbjct: 257 P 257 Score = 30.7 bits (66), Expect = 3.3 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 3/79 (3%) Frame = +1 Query: 1315 PRRXRG-GRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAP-PXPXXXTPXGXPXGGX 1488 P R G G GPPP + PP + P G P P P P Sbjct: 215 PGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRRD 274 Query: 1489 XPPXGXP-GXXXPGPPXXG 1542 PP G P G PG P G Sbjct: 275 MPPPGAPPGMLPPGMPPHG 293 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 31.5 bits (68), Expect = 1.9 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 3/66 (4%) Frame = +1 Query: 1354 PPXXXFGEXGXRGAPPXTXPXGGXP-RGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXP-- 1524 PP F G PP + P P + P P TP G P G P G P P Sbjct: 967 PPS--FPPSSMGGFPPSSQPSMYNPGQVQPGYPGAMTP-GAPSPGVPSPTGLPPSGPPPT 1023 Query: 1525 GPPXXG 1542 GPP G Sbjct: 1024 GPPADG 1029 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.5 bits (68), Expect = 1.9 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 6/79 (7%) Frame = +1 Query: 1315 PRRXRGGRXXAGPP---PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTP---XGXP 1476 PR G GPP P G RG PP PRG PP P P G P Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPP 498 Query: 1477 XGGXXPPXGXPGXXXPGPP 1533 PP GPP Sbjct: 499 PPRGMPPPPRQRMPSQGPP 517 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -2 Query: 1511 PGXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXXXG 1356 PG GG P G P G G GG P G P G + GG P P G Sbjct: 179 PGGMPGGM--PGGMPGGFP--GAGGMPGGFPGAGGMPGGFPGAGGMPGGPGG 226 Score = 29.5 bits (63), Expect = 7.6 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -2 Query: 1475 GXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXXXGGG 1350 G P G+ GG P G P G + GG P P G G Sbjct: 177 GFPGGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAG 218 >SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) Length = 270 Score = 31.1 bits (67), Expect = 2.5 Identities = 40/143 (27%), Positives = 43/143 (30%), Gaps = 16/143 (11%) Frame = +1 Query: 1132 PDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGF---RAQXXXANPXS 1302 P P GP P+ PG P G GP P GF R P Sbjct: 22 PPGPEGNMGPRGQPGPEGSPGLPGERGTGGVPGPKGKQGAPGTIGFPGSRGDTGDLGPPG 81 Query: 1303 RXXXPRRXR----GGRXXAGPPPX-------XXFGEXGXRGAPPXTXPXGGXPRGAPPXP 1449 P + G AGPP G G G T P G P+G P P Sbjct: 82 AKGLPGAQQYGLPGPLGEAGPPGSQGSPGAPGIIGMNGAMGKKGDTGPLG--PKGQPGSP 139 Query: 1450 XXXTPXGXPXGGXXPP--XGXPG 1512 P P G PP G PG Sbjct: 140 GIDIP--GPKGMDGPPGEKGLPG 160 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.1 bits (67), Expect = 2.5 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGP 1530 PPP G G P P G + PP P GG PP P P P Sbjct: 175 PPP----GHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAP 230 Query: 1531 PXXG 1542 P G Sbjct: 231 PPQG 234 Score = 30.7 bits (66), Expect = 3.3 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 1340 PXPGPRPXXXSGNXAXGAXPPXPXPGXAXPGG---PPLXXXXXPXGXXRXGXXPPPXXSX 1510 P PG +P G PP P PGG PP P G G PPP Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPG----GYAPPPYVPQ 212 Query: 1511 XXGAXAP 1531 G P Sbjct: 213 EGGGIPP 219 Score = 29.1 bits (62), Expect = 10.0 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = +1 Query: 1351 PPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPX--PXXXTPXGXPXGGXXPPXGXPGXXXP 1524 PPP APP P G G PP P P P G PP G PG Sbjct: 191 PPPGGYQQPPPGGYAPPPYVPQEGG--GIPPQNHPLTNYPAPPPQGYAPPPGGYPG---- 244 Query: 1525 GPPXXG 1542 PP G Sbjct: 245 APPAGG 250 >SB_54954| Best HMM Match : zf-RanBP (HMM E-Value=2.1) Length = 172 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +1 Query: 1387 RGAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 R P T P G P P P TP PP G P P Sbjct: 113 RKTPAATTPPTGAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTP 161 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 3/48 (6%) Frame = +1 Query: 1390 GAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 GAP T P P P P TP PP G P P Sbjct: 124 GAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTPPTGAPAATTP 171 >SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +1 Query: 1387 RGAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 R P T P G P P P TP PP G P P Sbjct: 180 RKTPAATTPPTGAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTP 228 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 3/48 (6%) Frame = +1 Query: 1390 GAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 GAP T P P P P TP PP G P P Sbjct: 191 GAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTPPTGAPASTTP 238 >SB_44302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +1 Query: 1387 RGAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 R P T P G P P P TP PP G P P Sbjct: 3 RKTPAATTPPTGAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTP 51 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 3/48 (6%) Frame = +1 Query: 1390 GAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 GAP T P P P P TP PP G P P Sbjct: 14 GAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTPPTGAPAATTP 61 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.7 bits (66), Expect = 3.3 Identities = 26/99 (26%), Positives = 29/99 (29%) Frame = +1 Query: 1246 PVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGX 1425 P P A A A P S+ P + P P + P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMST 366 Query: 1426 PRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPPXXG 1542 P PP P GG PP PG PGPP G Sbjct: 367 PVQRPPGMRPPGAGNGP-GGPPPPWSKPGGILPGPPPPG 404 >SB_42153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +1 Query: 1387 RGAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 R P T P G P P P TP PP G P P Sbjct: 66 RKTPAATTPPTGAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTP 114 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 3/48 (6%) Frame = +1 Query: 1390 GAPPXTXPXGGXPRGAPP---XPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 GAP T P P P P TP PP G P P Sbjct: 77 GAPAATTPPTAAPAATTPPTAAPAATTPPTGAPAATTPPTGAPASTTP 124 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 4.3 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +1 Query: 1336 RXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGX 1515 R PPP G APP T P P P P G PP P Sbjct: 211 RSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP---PPK 267 Query: 1516 XXPGPPXXG 1542 P PP G Sbjct: 268 NAPPPPKRG 276 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 30.3 bits (65), Expect = 4.3 Identities = 18/60 (30%), Positives = 21/60 (35%) Frame = -2 Query: 1493 GXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXXXGGGPAXXRPPRXRLG 1314 G PP G P G GG PRG P G P + GG P + + G Sbjct: 493 GGGPPRGGPRGGRGGSRGGPPRGAPRG---RSGPPRGRGGGDFGGRGGRGGTTPGKRKYG 549 Score = 29.9 bits (64), Expect = 5.7 Identities = 33/114 (28%), Positives = 34/114 (29%), Gaps = 1/114 (0%) Frame = +1 Query: 1189 PGPPXXARXRGG-GGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPPPXX 1365 PG R RGG GGP P G+ Q S GG Sbjct: 426 PGGGYEGRGRGGRGGPRGGGPRGYDGGY-GQGGGYEGYSGGYRDDYGYGGGSYDHYDSYY 484 Query: 1366 XFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPG 1527 G G P P GG PRG P G P G PP G G G Sbjct: 485 GGGYDDYYGGGP---PRGG-PRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGG 534 >SB_17493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 718 Score = 30.3 bits (65), Expect = 4.3 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 1494 GGXXPXRXXPXGXXXXXRG-GPPGXAXPGXGXGGXAPXAXFPEXXXGRGPGXGXAPP 1327 GG P P G G GPPG G GG P + G PG G PP Sbjct: 281 GGVTPPGMYPSGIGSPSIGSGPPGMEEGPPGTGGGPPGSV------GAPPGMGDGPP 331 Score = 29.1 bits (62), Expect = 10.0 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -2 Query: 1496 GGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXGGAPLXPXSPNXXXGGGP 1347 GG PP P G+ G P G GG P G GP Sbjct: 281 GGVTPPGMYPSGIGSPSIGSGPPGMEEGPPGTGGGPPGSVGAPPGMGDGP 330 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 4.3 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +1 Query: 1336 RXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGX 1515 R PPP G APP T P P P P G PP P Sbjct: 123 RSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP---PPK 179 Query: 1516 XXPGPPXXG 1542 P PP G Sbjct: 180 NAPPPPKRG 188 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.3 bits (65), Expect = 4.3 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 1387 RGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 +G PP PP P TP G PP P P PP Sbjct: 266 KGHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP 314 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.3 bits (65), Expect = 4.3 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 1372 GEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 G G G P P P +PP P TP P PP P P PP Sbjct: 337 GTSGGGGVNPPPPPTNNPP--SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 >SB_27478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.9 bits (64), Expect = 5.7 Identities = 21/74 (28%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +1 Query: 1315 PRRXRGGRXXAGPP-PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXX 1491 P +G GP P G+ G G T P G P P T P G Sbjct: 26 PTGPKGDTGATGPTGPTGPKGDTGATGPTGPTGPKGDTGATGPTGPKGDTGATGPTG--- 82 Query: 1492 PPXGXPGXXXPGPP 1533 P G G P P Sbjct: 83 -PKGDTGATGPNGP 95 Score = 29.9 bits (64), Expect = 5.7 Identities = 33/139 (23%), Positives = 36/139 (25%), Gaps = 5/139 (3%) Frame = +1 Query: 1132 PDRPCLGXGPXQXXLPKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXX 1311 P P GP P GP G GP G + P Sbjct: 104 PAGPTGPTGPKGDTGPTDPTGPNGDTGATGPTGPKGDTGATGPTGPKGDTGATGPTGPTG 163 Query: 1312 XPRRXRGGRXXAGPPPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXX 1491 P+ G AGP G G +G T P G P T P G Sbjct: 164 -PKGDTGATGPAGPT-----GPTGPKGDTGATGPAGPAGPTGPKGDTGATGPTDPTGPTG 217 Query: 1492 P-----PXGXPGXXXPGPP 1533 P P G G P P Sbjct: 218 PKGPTGPKGEIGATGPTDP 236 Score = 29.9 bits (64), Expect = 5.7 Identities = 30/125 (24%), Positives = 31/125 (24%), Gaps = 6/125 (4%) Frame = +1 Query: 1177 PKXXPGPPXXARXRGGGGPXFXXPVPXGAGFRAQXXXANPXSRXXXPRRXRGGRXXAGPP 1356 P GP G GP G P P +G GP Sbjct: 176 PTGPTGPKGDTGATGPAGPAGPTGPKGDTGATGPTDPTGPTGPKG-PTGPKGEIGATGPT 234 Query: 1357 ----PXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXP--PXGXPGXX 1518 P G G G T P G P P T P G P P G G Sbjct: 235 DPTGPKGDTGATGPTGPTGPTGPKGDTGATGPTGPKGDTGATGPAGPTGPTGPKGDTGAT 294 Query: 1519 XPGPP 1533 P P Sbjct: 295 GPAGP 299 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 29.9 bits (64), Expect = 5.7 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +1 Query: 1354 PPXXXFGEXGXRGAPPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 PP GAPP P G P G P P G G P G P P Sbjct: 587 PPAGVQPPQSGSGAPPAMPPPVGAP-GGQPSYSHPMPQGYAPQGYQPEYGGQSMQPPPPK 645 Query: 1534 XXG 1542 G Sbjct: 646 TEG 648 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 29.5 bits (63), Expect = 7.6 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +1 Query: 1348 GPPPXXXFGEXGXRGAPPXTXPXGGXPRG----APPXPXXXTPXGXPXGGXXPPXGXPGX 1515 GP P G+ G RG P GG P G P P P G G PP P Sbjct: 323 GPDPR---GDRGPRGPPSGVPTSGGPPPGHQGLRPSGPNNQGPPG--PGPNMPPVSGPSN 377 Query: 1516 XXPG 1527 PG Sbjct: 378 PAPG 381 >SB_42474| Best HMM Match : Collagen (HMM E-Value=0.14) Length = 221 Score = 29.5 bits (63), Expect = 7.6 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 7/83 (8%) Frame = +1 Query: 1207 ARXRGGG---GPXFXXPVPXG-AGFRAQXXXANPXSRXXXPR---RXRGGRXXAGPPPXX 1365 AR RG G GP G AGFR R R RGG GP Sbjct: 94 ARGRGRGMARGPGRGMVGARGRAGFRGNRGGFTSPGRGGAAGFRGRGRGGMTRGGPRGRA 153 Query: 1366 XFGEXGXRGAPPXTXPXGGXPRG 1434 FG G RGA G RG Sbjct: 154 SFGGRGARGASRGAARGGRGGRG 176 >SB_12790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.5 bits (63), Expect = 7.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 1396 PPXTXPXGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXP 1524 PP P P A P P G P PP G P P Sbjct: 74 PPTVAPAATTPPTAAPA-ATTPPTGAPAA-TTPPTGAPAATTP 114 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 29.5 bits (63), Expect = 7.6 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -2 Query: 1532 GGPGXXXPGXPXGGXXPPXGXPXGVXXXGX--GGAPRGXPPXGXVXGGAPLXPXSPNXXX 1359 GG G GG G G G GG+ G G GG + S Sbjct: 124 GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIA 183 Query: 1358 GGG 1350 GGG Sbjct: 184 GGG 186 >SB_50275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 29.5 bits (63), Expect = 7.6 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 1390 GAPPXTXPXG---GXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 G P T P G G P GAP TP G P G P G P G P Sbjct: 15 GTPEGT-PEGTPEGTPEGAPEGTPEGTPEGTPEG---TPEGTPEGTPEGTP 61 Score = 29.5 bits (63), Expect = 7.6 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 1390 GAPPXTXPXG---GXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXXPGPP 1533 GAP T P G G P G P TP G P G P G P G P Sbjct: 31 GAPEGT-PEGTPEGTPEGTPEGTPEGTPEGTPEG---TPEGTPEGTPEGTP 77 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 29.5 bits (63), Expect = 7.6 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +1 Query: 1345 AGPPPXXXFGEXGXRGAPPXTXP-XGGXPRGAPPXPXXXTPXGXPXGGXXPPXGXPGXXX 1521 A PPP GAP + P GG P G P P P G PP Sbjct: 486 APPPPPPSDAMMQGMGAPSMSEPPAGGPPMGQGPPRPPTNPTAAPMG--QPPSMTSALSS 543 Query: 1522 PGP 1530 GP Sbjct: 544 NGP 546 >SB_58049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 29.1 bits (62), Expect = 10.0 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 1508 GXPXGGXXPPXGXPXGVXXXGXGGAPRGXPPXGXVXG-GAPLXPXSPNXXXGGGPAXXRP 1332 G P P P G+ G GAP P G G GAP P SP GPA P Sbjct: 265 GAPGFPGAPGFQGPPGLD--GMPGAPGMPGPQGYPGGSGAPGIPGSPGMPGPPGPAGPTP 322 Query: 1331 PR 1326 R Sbjct: 323 IR 324 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.1 bits (62), Expect = 10.0 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +2 Query: 1328 GGAXPXPGPRPXXXS-GNXAXGAXPPXPXPGXAXPGGPPLXXXXXPXGXXRXGXXPPP 1498 GG P PG P G G PP P PG A GGPP P G PPP Sbjct: 35 GGYPPAPGGYPPSGGYGYPPAGGYPP-PQPGYA--GGPP------PPGIAPGIGGPPP 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,577,012 Number of Sequences: 59808 Number of extensions: 612393 Number of successful extensions: 3255 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 2433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2940 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5047244110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -