BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A10_e457_02.seq (1515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosacc... 159 7e-40 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 29 1.3 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 5.1 >SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 159 bits (387), Expect = 7e-40 Identities = 68/113 (60%), Positives = 90/113 (79%) Frame = +2 Query: 173 QYKEEHSFEKRKTEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFL 352 Q+K++ SFEKRKTE ++IR KYPDR+PVI EK K+ + +DKKKYLVPSDLTVGQF ++ Sbjct: 4 QFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYV 63 Query: 353 IRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 511 IRKRI L PE A+F F++ ++PPT+A M ++Y+EH ED FLYI +S EN +G Sbjct: 64 IRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFG 116 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 1204 SQSTXGPXNLREPXPXKXKPGXLAXSXPFXPPP 1302 S S GP +P KPG A + P PPP Sbjct: 384 STSKTGPLFGNKPADPSAKPGATASTTPSEPPP 416 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 886 PPFASWRNSEEARTDRPSQQXRSLN 960 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,786,761 Number of Sequences: 5004 Number of extensions: 89450 Number of successful extensions: 183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 848370472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -