BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A03_e401_01.seq (1507 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 26 0.83 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 25.8 bits (54), Expect = 0.83 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = -1 Query: 334 PSAANVTSTKSPRDSRP*KPADIFAWKLFQHNENCSSDAMMAATVGTLS*ALYSIIPILE 155 P+ A+ T T S S PA I ++ L QH CSS + +T + + Y+ P Sbjct: 203 PTIASATYTNSANSSIW-SPASIDSFTLEQHRSWCSSSQPVLSTTNSTT-NCYNNYPYYS 260 Query: 154 TFD 146 D Sbjct: 261 NMD 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 261,996 Number of Sequences: 336 Number of extensions: 4662 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45169425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -