BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A03_e401_01.seq (1507 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy... 31 0.31 SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 29 1.3 >SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 31.5 bits (68), Expect = 0.31 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 312 DVTLAAEGRLLQAHKLVLSVCSPYFQEMF-KMNPTQHPIVFLKDVSHSA--LRDLLQFMY 482 D+ A + + AHK L+ S YF+ F K+ P++H I +V H A +L+++Y Sbjct: 168 DIVFAGQYGRVFAHKFYLAARSSYFKSKFSKLGPSEHEI----EVKHFAKEFESILRYLY 223 >SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -2 Query: 369 LIKLIYVPVTICLRQPMLRLLNLHATAGHESLLTYSRGNCSNIMRIV 229 L+ L Y C+ LR L H T GH LL +S N + IV Sbjct: 16 LVILFYAKNRFCISIDHLRPLKSHRTHGHYCLLNFSLRENKNYLIIV 62 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,486,153 Number of Sequences: 5004 Number of extensions: 78642 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 842423950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -