BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A02_e393_02.seq (1501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 134 2e-31 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 115 9e-26 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 106 4e-23 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 105 1e-22 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 103 4e-22 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 96 6e-20 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 1e-19 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 95 1e-19 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 9e-19 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-18 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 87 3e-17 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 87 3e-17 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 85 1e-16 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 71 3e-12 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 70 6e-12 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 64 3e-10 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 60 5e-09 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 55 2e-07 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 5e-07 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-07 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 52 9e-07 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 51 3e-06 SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 42 0.002 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 41 0.002 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 41 0.002 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) 39 0.009 SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 38 0.027 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.048 SB_43289| Best HMM Match : DUF196 (HMM E-Value=5.5) 36 0.084 SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.084 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 32 1.0 SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) 31 3.2 SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) 30 4.2 SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 29 9.6 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 134 bits (324), Expect = 2e-31 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 1/118 (0%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 DYY +LGV RSA++ ++KKAYR+ AL+WHPDKNP N + A +FK++SEAYEVLSD+ KR Sbjct: 4 DYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKR 63 Query: 698 RVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG-SPFSSLFA 868 +YD+YGKEGL S+G + +E + + FR P+E+FREFFGG PF F+ Sbjct: 64 DIYDKYGKEGL-TSQG--TPREETFG-ASGVHVHVFRSPDEIFREFFGGFDPFEDFFS 117 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 115 bits (277), Expect = 9e-26 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 1/118 (0%) Frame = +2 Query: 515 VDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERK 694 +DYY ILG++RSATDA+IKK YRKL+LK+HPDKN + + E +F++ +EAY+VLSD +K Sbjct: 3 LDYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEV--KFRQAAEAYDVLSDPKK 60 Query: 695 RRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG-SPFSSLF 865 R +Y+Q+G+EGL + + A + Y + D VFREFFGG +PFS LF Sbjct: 61 RAIYNQFGEEGLKSGVPEKDAWTQGYTF--------HGDANRVFREFFGGNNPFSELF 110 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 106 bits (255), Expect = 4e-23 Identities = 55/121 (45%), Positives = 75/121 (61%), Gaps = 6/121 (4%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 DYY +L V ++A+ +IKKAYRK ALK+HPDKN + A +FKEISEAYEVLSD +K+ Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDKN--KSPGAEEKFKEISEAYEVLSDPKKK 61 Query: 698 RVYDQYGKEGLN-----NSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG-SPFSS 859 +YDQYG+EGL + G + ++ G+ + +T D E F FG PF+ Sbjct: 62 EIYDQYGEEGLKGTPPPQNGGGHGFSGANFGPGFTTFTYTSGDARETFSRVFGDEDPFAD 121 Query: 860 L 862 L Sbjct: 122 L 122 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 105 bits (251), Expect = 1e-22 Identities = 46/74 (62%), Positives = 62/74 (83%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 DYY+ILGV R+A+D +IKKA+RK+A+K+HPDKN +A +F+E++EAYEVLSDE KR Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKN--KGKDAEEKFREVAEAYEVLSDENKR 83 Query: 698 RVYDQYGKEGLNNS 739 R YDQ+G+EGL N+ Sbjct: 84 RQYDQFGEEGLKNN 97 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 103 bits (248), Expect = 3e-22 Identities = 56/116 (48%), Positives = 70/116 (60%), Gaps = 4/116 (3%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY ILGV + A+D E+KKAY+K A K+HPDKN D A +FKEI+EAYEVLSD +KR Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPG--AEEKFKEIAEAYEVLSDPQKR 61 Query: 698 RVYDQYGKEGLNNSRGRRSANDED---YEYGYANYPFTFRDPEEVFREFFGG-SPF 853 ++DQYG+EGL A D D G+ + F DP F FG PF Sbjct: 62 EIFDQYGEEGLKGGVPPPGAGDADGFQMPEGFTYFQF-HGDPRATFSRVFGDEDPF 116 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 103 bits (247), Expect = 4e-22 Identities = 58/116 (50%), Positives = 70/116 (60%) Frame = +2 Query: 512 MVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDER 691 M DYY IL V RSA++ +IKK+YRKLALKWHPDKNP N +EA R+FKEISEAYEVLSD Sbjct: 1 MADYYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD-- 58 Query: 692 KRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGGSPFSS 859 Y G GL + R N D+ ++P F + FG PFS+ Sbjct: 59 ----YPFGGMAGLGSHR-----NGSDHPMRGFHHPMRGMHHPFSFSDGFGSDPFSA 105 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 96.3 bits (229), Expect = 6e-20 Identities = 50/108 (46%), Positives = 72/108 (66%), Gaps = 1/108 (0%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY ILGV R+A+D +IKKAYR+ AL +HPDKN ++ A +FKEISEAY+VL+D R+R Sbjct: 4 NYYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSG--AEEKFKEISEAYKVLTDPRQR 61 Query: 698 RVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF-RDPEEVFREFF 838 ++D YG+EGL + +D + + F+F DP ++F E F Sbjct: 62 DIFDMYGEEGL------KGTSDSPFGGPCGGFGFSFSEDPMKIFAEVF 103 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 95.1 bits (226), Expect = 1e-19 Identities = 44/70 (62%), Positives = 56/70 (80%) Frame = +2 Query: 521 YYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRR 700 YY IL V +AT EIKK+YRKLALK+HPDKNPD D RFK+IS+AYEVLSDE+KR+ Sbjct: 66 YYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGD----RFKQISQAYEVLSDEKKRK 121 Query: 701 VYDQYGKEGL 730 +YD+ G++ + Sbjct: 122 IYDEGGEDAI 131 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 95.1 bits (226), Expect = 1e-19 Identities = 49/94 (52%), Positives = 67/94 (71%) Frame = +2 Query: 482 SLNTL*GRAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEIS 661 S+ TL GR D+Y ILGV R A+ +IK+AYRKLA+K HPDKN D+ +A +F +I Sbjct: 17 SIQTLAGR----DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDD-PKAQEKFHDIG 71 Query: 662 EAYEVLSDERKRRVYDQYGKEGLNNSRGRRSAND 763 AYEVL+D+ +R++YDQ G+EGL N+ G R +D Sbjct: 72 AAYEVLADDDQRKIYDQRGEEGLKNA-GHRDHSD 104 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 92.3 bits (219), Expect = 9e-19 Identities = 38/68 (55%), Positives = 53/68 (77%) Frame = +2 Query: 521 YYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRR 700 +Y +LGV R D+ +KK YRKLALKWHPDKN DNA+E+ R F+EI +AY+VLSD ++R Sbjct: 5 HYEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERA 64 Query: 701 VYDQYGKE 724 YD++ ++ Sbjct: 65 FYDKHREQ 72 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 91.5 bits (217), Expect = 2e-18 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 2/118 (1%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 DYY+ILGV +A EIKKAY +LA K+HPD N D + A+ +F+E+SEAYEVLSD+ KR Sbjct: 59 DYYKILGVPPNANQKEIKKAYFELAKKYHPDTNKDKS--ASEKFQEVSEAYEVLSDDGKR 116 Query: 698 RVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG--SPFSSLF 865 + YD +G+ + ++G +G A + D E++ + FFGG PF F Sbjct: 117 KAYDSFGQTDFSGAQGG--------PFGGAGF-----DAEDILKSFFGGQSGPFGGGF 161 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 87.4 bits (207), Expect = 3e-17 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = +2 Query: 524 YRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRRV 703 Y +LGV ++A+D +IKKAYRKLA + HPDKNPD + +FK+I+ AYE+LSD KR + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGE----KFKDITFAYEILSDPEKREL 62 Query: 704 YDQYGKEGLNNSRG 745 YD+YG++GL G Sbjct: 63 YDRYGEKGLREGAG 76 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 87.4 bits (207), Expect = 3e-17 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = +2 Query: 524 YRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRRV 703 Y +LGV ++A+D +IKKAYRKLA + HPDKNPD + +FK+I+ AYE+LSD KR + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGE----KFKDITFAYEILSDPEKREL 62 Query: 704 YDQYGKEGLNNSRG 745 YD+YG++GL G Sbjct: 63 YDRYGEKGLREGAG 76 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 85.4 bits (202), Expect = 1e-16 Identities = 48/118 (40%), Positives = 72/118 (61%), Gaps = 4/118 (3%) Frame = +2 Query: 503 RAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADE----ANRRFKEISEAY 670 +++ DYY+IL +S++A++ EIKKAY+K ALK HPD++ +DE A ++FKE++EAY Sbjct: 154 KSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAY 213 Query: 671 EVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG 844 +LSD +K+R YD + +D E GY F DP +F+ FFGG Sbjct: 214 SILSDPKKKRRYD----------------SGQDLEEGYGMDDF---DPNSIFQAFFGG 252 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 85.4 bits (202), Expect = 1e-16 Identities = 48/118 (40%), Positives = 72/118 (61%), Gaps = 4/118 (3%) Frame = +2 Query: 503 RAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADE----ANRRFKEISEAY 670 +++ DYY+IL +S++A++ EIKKAY+K ALK HPD++ +DE A ++FKE++EAY Sbjct: 154 KSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAY 213 Query: 671 EVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTFRDPEEVFREFFGG 844 +LSD +K+R YD + +D E GY F DP +F+ FFGG Sbjct: 214 SILSDPKKKRRYD----------------SGQDLEEGYGMDDF---DPNSIFQAFFGG 252 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 81.4 bits (192), Expect = 2e-15 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 6/121 (4%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY +LGV R+AT +I++AYR+LALK+HPDKN + FKE+SEAYEVL D ++R Sbjct: 4 NYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEE----NFKEVSEAYEVLCDPQQR 59 Query: 698 RVYD-QYGKEGLNNSRGRRSANDEDYEY---GYANYPF--TFRDPEEVFREFFGGSPFSS 859 +D ++ + S +R A DYE G+ N F T + + +F F FS Sbjct: 60 ERFDKKFAPDTFRYSYSKR-ATSFDYEVNCGGFRNSHFSCTTEEAKRMFSRSFCDEDFSD 118 Query: 860 L 862 L Sbjct: 119 L 119 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 81.4 bits (192), Expect = 2e-15 Identities = 38/77 (49%), Positives = 53/77 (68%) Frame = +2 Query: 470 LF*DSLNTL*GRAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRF 649 L+ D + L R E + YR+LG++ AT EIKK Y+KLA+KWHPD++ DN +EA + F Sbjct: 779 LYDDFVKALDPRGEK-NSYRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHF 837 Query: 650 KEISEAYEVLSDERKRR 700 EI EAYE+LS + +R Sbjct: 838 MEIQEAYEILSKLKTKR 854 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 74.1 bits (174), Expect = 3e-13 Identities = 36/86 (41%), Positives = 63/86 (73%), Gaps = 1/86 (1%) Frame = +2 Query: 467 MLF*DSLNTL*GRAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDK-NPDNADEANR 643 M F D L+ L G + + Y +LGVS++A+++EIK+AYRK++L+ HPD+ + ++A R Sbjct: 1 MPFLDELDRLFG---VKNLYDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATR 57 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGK 721 +F+ +S++Y +LSD+ KR +YD+ G+ Sbjct: 58 KFQALSKSYCILSDKEKRAIYDESGE 83 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 70.9 bits (166), Expect = 2e-12 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +2 Query: 479 DSLNTL*GRAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDK-NPDNADEANRRFKE 655 D L +++ DYY+ILG+ R+ EI KAYRKLA+KWHPD ++ +A + F + Sbjct: 195 DRAQRLLKQSQKRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFID 254 Query: 656 ISEAYEVLSDERKRRVYD 709 I+ A EVL+D KR YD Sbjct: 255 IAAAKEVLTDPEKRAKYD 272 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/75 (41%), Positives = 54/75 (72%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 ++Y++LGV +AT AEI++AYR+++L+ HPD+N + D+A +F+++ EVL DE KR Sbjct: 2483 NFYQVLGVETTATQAEIRRAYRRISLQLHPDRNKE--DDAELKFRKLVAVAEVLKDEDKR 2540 Query: 698 RVYDQYGKEGLNNSR 742 + YD ++G+ + R Sbjct: 2541 KRYDTILRDGMPDWR 2555 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 69.7 bits (163), Expect = 6e-12 Identities = 33/64 (51%), Positives = 46/64 (71%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY LGV + +T+ EI KAYRK ALK HPDKNPDN +A+ F ++S+A EVL+D + R Sbjct: 7 NYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDN-PKASELFHKLSKALEVLTDPKAR 65 Query: 698 RVYD 709 ++ Sbjct: 66 AAFN 69 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 64.1 bits (149), Expect = 3e-10 Identities = 29/65 (44%), Positives = 46/65 (70%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY +LGVS A+ ++IK AY KL++K HPD++ +D+ + F+EI+EAY VL + R Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRH-QGSDKKHEVFQEIAEAYSVLGNLESR 130 Query: 698 RVYDQ 712 + YD+ Sbjct: 131 KQYDR 135 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 64.1 bits (149), Expect = 3e-10 Identities = 29/65 (44%), Positives = 46/65 (70%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 +YY +LGVS A+ ++IK AY KL++K HPD++ +D+ + F+EI+EAY VL + R Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRH-QGSDKKHEVFQEIAEAYSVLGNLESR 130 Query: 698 RVYDQ 712 + YD+ Sbjct: 131 KQYDR 135 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 60.1 bits (139), Expect = 5e-09 Identities = 28/69 (40%), Positives = 44/69 (63%) Frame = +2 Query: 503 RAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLS 682 R + ++Y IL V + A+ EIK A+ K ++HPD NPD+ D +++ F ++SEAY LS Sbjct: 3 RQKKKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPD-SHKAFIKVSEAYTTLS 61 Query: 683 DERKRRVYD 709 +R+ YD Sbjct: 62 SSARRQQYD 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 60.1 bits (139), Expect = 5e-09 Identities = 28/69 (40%), Positives = 44/69 (63%) Frame = +2 Query: 503 RAEMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLS 682 R + ++Y IL V + A+ EIK A+ K ++HPD NPD+ D +++ F ++SEAY LS Sbjct: 64 RQKKKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPD-SHKAFIKVSEAYTTLS 122 Query: 683 DERKRRVYD 709 +R+ YD Sbjct: 123 SSARRQQYD 131 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 54.8 bits (126), Expect = 2e-07 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = +2 Query: 509 EMVDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDE 688 E+ D+Y +L AT+ +I ++K A +WHPDK ++ D ++ F + +A +VL DE Sbjct: 285 ELEDFYSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTD-SHEYFARLKKARDVLCDE 343 Query: 689 RKRRVYDQY 715 + R YD + Sbjct: 344 KMRAKYDHW 352 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKN 616 DYY + G+SR AT EI+KA++KLAL+ HPDKN Sbjct: 28 DYYELFGISRDATSKEIRKAFKKLALRLHPDKN 60 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 46.4 bits (105), Expect(2) = 7e-07 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = +2 Query: 515 VDYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPD 622 VDYY +L V + A + E+K AYR+L + +HPDK+ D Sbjct: 130 VDYYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTD 165 Score = 25.8 bits (54), Expect(2) = 7e-07 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 647 FKEISEAYEVLSDERKRRVY 706 F ++ +AYEVLSD + +Y Sbjct: 202 FSKVQKAYEVLSDPETKAIY 221 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 52.4 bits (120), Expect = 9e-07 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 ++Y ++ + +AT EIK AY +L+ +HPD N ++ EA RF E++ AY LS R Sbjct: 51 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLN--SSAEARERFAELTLAYNTLSRLETR 108 Query: 698 RVYD-QYGKEGLNNSRGRRSAND 763 R YD Q G + S R+S + Sbjct: 109 REYDKQIGTYYMTRSLTRKSEGE 131 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 52.4 bits (120), Expect = 9e-07 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKR 697 ++Y ++ + +AT EIK AY +L+ +HPD N ++ EA RF E++ AY LS R Sbjct: 198 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLN--SSAEARERFAELTLAYNTLSRLETR 255 Query: 698 RVYD-QYGKEGLNNSRGRRSAND 763 R YD Q G + S R+S + Sbjct: 256 REYDKQIGTYYMTRSLTRKSEGE 278 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/59 (42%), Positives = 37/59 (62%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERK 694 D Y +L + R A+ AEI++ YR L+ K+HPDK + R+F I++AYE +SD K Sbjct: 1248 DPYAVLEIDRGASVAEIRRQYRSLSKKYHPDKETGDP----RKFMRIAKAYEAVSDFNK 1302 >SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4275 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/75 (26%), Positives = 35/75 (46%) Frame = +2 Query: 569 KKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGR 748 +K ++L LKWHPDKNPD+ + + F+ + + L + K V+ G + R Sbjct: 4044 RKIIKRLFLKWHPDKNPDDVEFCTKVFQHLQNEIQRL-ESGKASVFHSSGFSDFHGFSQR 4102 Query: 749 RSANDEDYEYGYANY 793 Y +++Y Sbjct: 4103 WGRRARSYGQSWSSY 4117 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 6/64 (9%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDK------NPDNADEANRRFKEISEAYEVL 679 D +LGV + IK+AYRKL + HPDK P+ + A ++ +EI +AYE++ Sbjct: 75 DACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELI 134 Query: 680 SDER 691 ++ Sbjct: 135 KQQK 138 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDK 613 D Y ILGV A+D +IK+ YRKLA+ HPDK Sbjct: 800 DPYSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +2 Query: 539 VSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRRVYD 709 +S+ +KKA RK L WHPDKN +A++A + I AY L D+ R Y+ Sbjct: 146 LSKDELKKTLKKACRKQLLIWHPDKNGGDAEQA----RNIIMAYSCLEDDETRARYN 198 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 40.7 bits (91), Expect = 0.003 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = +2 Query: 518 DYYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEIS 661 D+Y LG+ + AT +I +AY+KLA+ HPDK+ A + FK +S Sbjct: 143 DHYERLGIQQGATKDDINRAYKKLAVLIHPDKSV--APGSEEAFKALS 188 >SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1644 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/75 (26%), Positives = 35/75 (46%) Frame = +2 Query: 569 KKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGR 748 +K ++L LKWHPDKNPD+ + + F+ + + L + K V+ G + R Sbjct: 1390 RKIIKRLFLKWHPDKNPDDVEFCTKVFQHLQNEIQRL-EIGKASVFHSSGFSDFHGFSQR 1448 Query: 749 RSANDEDYEYGYANY 793 Y +++Y Sbjct: 1449 WGRRARSYGQSWSSY 1463 >SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) Length = 106 Score = 39.1 bits (87), Expect = 0.009 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = +2 Query: 539 VSRSATDAEIKKAYRKLALKWHPDKNPD 622 +S + +++I+KAY +LA K+HPDKNPD Sbjct: 77 ISGALDESKIRKAYFRLAQKYHPDKNPD 104 >SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 926 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +2 Query: 524 YRILGVSRSATDA-EIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVL 679 Y +LG+ + T + + ++AY KLA ++HPD AD RF I AY V+ Sbjct: 391 YMLLGLEKGKTGSVDAREAYLKLAKQYHPDSGKSTAD--GERFAMIEHAYRVV 441 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 37.5 bits (83), Expect = 0.027 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 530 ILGVSRSATDAEIKKAYRKLALKWHPDK 613 ILGV A+D +IK+ YRKLA+ HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 36.7 bits (81), Expect = 0.048 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 557 DAEIKKAYRKLALKWHPDKNP--DNADEANR-RFKEISEAYEVLSDERKRRVYDQYGKEG 727 D + KK ++L L+WHPDKNP D A E + EI + + K+ ++ KE Sbjct: 4238 DVKRKKVMKRLFLRWHPDKNPGSDIATEVMKFLLSEIDRLERIFPSKEKKAKKEKEKKEK 4297 Query: 728 LNNS 739 S Sbjct: 4298 TEES 4301 >SB_43289| Best HMM Match : DUF196 (HMM E-Value=5.5) Length = 240 Score = 35.9 bits (79), Expect = 0.084 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 569 KKAYRKLALKWHPDKNPDNAD 631 +K ++L LKWHPDKNPD+ + Sbjct: 216 RKIIKRLFLKWHPDKNPDDVE 236 >SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 35.9 bits (79), Expect = 0.084 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 563 EIKKAYRKLALKWHPDKNPDNADEANRR--FKEISEAYEVLSDERKRRVY 706 ++KKAYRK L HPDK EA R F E++EA+ + + + +Y Sbjct: 484 DVKKAYRKAVLCVHPDKLTGEPHEALARAIFMELNEAWSLFEESGCKPLY 533 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +2 Query: 521 YYRILGVSRSATDAEIKKAYRKLALKWHPDKNPDNADEANRRF 649 +Y ++ + +AT EIK AY +L+ +HPD N ++ EA RF Sbjct: 76 HYDVMKLLPTATLREIKSAYYELSRIYHPDLN--SSAEARERF 116 >SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) Length = 1252 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -1 Query: 712 LIIYTAFPLV*KNFISLRYFLEPSVGFICVVWVFIWMPFQG*FSVCFLYL 563 L+ TA L ++IS+ Y+ + G +C VWVF+ + F + F ++ Sbjct: 207 LLALTAITLAGLSWISILYYSVFTFGTLCFVWVFLTNACELDFELAFKFI 256 >SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) Length = 966 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 657 YLRLMKFFQTRGNAVYMISTVKRG*ITVEEGVQQTT--KITSMATPTTHSHSEILK 818 YL F+ R +A+YM+ + G + EEG+++ K+ +M EI+K Sbjct: 641 YLPFGLLFEFRDHALYMLEKARSGIVEAEEGMERVNPEKLETMVKDVRKRTKEIVK 696 >SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1088 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 759 TTKITSMATPTTHSHSEILKRCLENSLEGHHLAVYSLKSTVTITTTGTDAEVTTR 923 TT++ +P + + K C +++ HL + SL S V +TT T TR Sbjct: 713 TTRVAVCFSPGIKKQASLAKLCFFSNISDQHL-LRSLLSVVAMTTNATTTTKPTR 766 >SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4994 Score = 29.1 bits (62), Expect = 9.6 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = -3 Query: 629 LRCLGFYLDAISRLIFCMLSLSLHLWHSGTHQVSCNSPPSQLSLKGCLKNLKITLALPAN 450 LR LD I R +FC S S + VS N+ + KG +ITLA+P Sbjct: 931 LRATRNALDGIKRRVFC--SSSTRSFSKRAFYVS-NALAVESYTKGPFFKAEITLAIPQV 987 Query: 449 VLMPTLK 429 ++ P+L+ Sbjct: 988 IIQPSLE 994 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 29.1 bits (62), Expect = 9.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 620 DNADEANRRFKEISEAYEVLSDERKRRVYD 709 D+ + A ++F+ I+ AYE L D +R YD Sbjct: 74 DDKENAIKKFQLIATAYETLKDPEQRNDYD 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,508,284 Number of Sequences: 59808 Number of extensions: 690457 Number of successful extensions: 1833 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 1648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1807 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4859439678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -